Identification
Name:Phosphocarrier protein HPr
Synonyms:
  • Histidine-containing protein
Gene Name:ptsH
Enzyme Class:Not Available
Biological Properties
General Function:Involved in sugar:hydrogen symporter activity
Specific Function:General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein HPr by enzyme I. Phospho-HPr then transfers it to the permease (enzymes II/III)
Cellular Location:Cytoplasm
SMPDB Pathways:
KEGG Pathways:
EcoCyc Reactions:
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
Complex Reactions:
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
1.0Thumb+1.0Thumb → 1.0Thumb+1.0Thumb
Metabolites:
ECMDB IDNameView
ECMDB200632(alpha-D-Mannosyl)-D-glycerateMetaboCard
ECMDB211352(alpha-D-Mannosyl-6-phosphate)-D-glycerateMetaboCard
ECMDB20117Arbutin 6-phosphateMetaboCard
ECMDB00044Ascorbic acidMetaboCard
ECMDB00660D-FructoseMetaboCard
ECMDB00122D-GlucoseMetaboCard
ECMDB00163D-MaltoseMetaboCard
ECMDB00169D-MannoseMetaboCard
ECMDB01882DihydroxyacetoneMetaboCard
ECMDB01473Dihydroxyacetone phosphateMetaboCard
ECMDB01076Fructose 1-phosphateMetaboCard
ECMDB00124Fructose 6-phosphateMetaboCard
ECMDB00107GalactitolMetaboCard
ECMDB20149Galactitol 1-phosphateMetaboCard
ECMDB01514GlucosamineMetaboCard
ECMDB01254Glucosamine 6-phosphateMetaboCard
ECMDB01401Glucose 6-phosphateMetaboCard
ECMDB20164L-Ascorbate 6-phosphateMetaboCard
ECMDB20171Maltose 6'-phosphateMetaboCard
ECMDB00765MannitolMetaboCard
ECMDB01078Mannose 6-phosphateMetaboCard
ECMDB00215N-Acetyl-D-glucosamineMetaboCard
ECMDB01062N-Acetyl-D-Glucosamine 6-PhosphateMetaboCard
ECMDB01121N-Acetyl-D-mannosamine 6-phosphateMetaboCard
ECMDB20176N-Acetyl-D-muramoateMetaboCard
ECMDB01129N-AcetylmannosamineMetaboCard
ECMDB20177N-Acetylmuramic acid 6-phosphateMetaboCard
ECMDB00263Phosphoenolpyruvic acidMetaboCard
ECMDB00243Pyruvic acidMetaboCard
ECMDB00247SorbitolMetaboCard
ECMDB01400Sorbitol-6-phosphateMetaboCard
ECMDB00258SucroseMetaboCard
ECMDB20196Sucrose-6-phosphateMetaboCard
ECMDB00975TrehaloseMetaboCard
ECMDB01124Trehalose 6-phosphateMetaboCard
GO Classification:
Function
cation transmembrane transporter activity
cation:sugar symporter activity
ion transmembrane transporter activity
solute:cation symporter activity
substrate-specific transmembrane transporter activity
sugar:hydrogen symporter activity
transmembrane transporter activity
transporter activity
Process
carbohydrate transport
establishment of localization
phosphoenolpyruvate-dependent sugar phosphotransferase system
transport
Gene Properties
Blattner:b2415
Gene OrientationClockwise
Centisome Percentage:54.57
Left Sequence End2531786
Right Sequence End2532043
Gene Sequence:
>258 bp
ATGAAAAACGTAAAAACCCTCATCGCTGCGGCGATTTTAAGCTCCATGTCATTTGCCAGC
TTTGCGGCTGTCGAAGTTCAGTCAACGCCAGAAGGCCAACAAAAAGTCGGTACAATCAGT
GCTAACGCGGGGACAAATCTGGGATCGCTGGAAGAGCAGCTGGCGCAAAAAGCGGATGAG
ATGGGCGCAAAATCTTTCCGTATTACTTCTGTAACCGGTCCGAATACCCTCCATGGAACA
GCAGTAATTTATAAATAA
Protein Properties
Pfam Domain Function:
Protein Residues:85
Protein Molecular Weight:9119
Protein Theoretical pI:6
PDB File:1VRC
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Phosphocarrier protein HPr
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE
References
External Links:
ResourceLink
Uniprot ID:P0AA04
Uniprot Name:PTHP_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:4062681
PDB ID:1VRC
Ecogene ID:EG10788
Ecocyc:EG10788
ColiBase:b2415
Kegg Gene:b2415
EchoBASE ID:EB0781
CCDB:PTHP_ECOLI
BacMap:16130341
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Byrne, C. R., Monroe, R. S., Ward, K. A., Kredich, N. M. (1988). "DNA sequences of the cysK regions of Salmonella typhimurium and Escherichia coli and linkage of the cysK regions to ptsH." J Bacteriol 170:3150-3157. Pubmed: 3290198
  • De Reuse, H., Danchin, A. (1988). "The ptsH, ptsI, and crr genes of the Escherichia coli phosphoenolpyruvate-dependent phosphotransferase system: a complex operon with several modes of transcription." J Bacteriol 170:3827-3837. Pubmed: 2457575
  • De Reuse, H., Roy, A., Danchin, A. (1985). "Analysis of the ptsH-ptsI-crr region in Escherichia coli K-12: nucleotide sequence of the ptsH gene." Gene 35:199-207. Pubmed: 2411636
  • Garrett, D. S., Seok, Y. J., Peterkofsky, A., Gronenborn, A. M., Clore, G. M. (1999). "Solution structure of the 40,000 Mr phosphoryl transfer complex between the N-terminal domain of enzyme I and HPr." Nat Struct Biol 6:166-173. Pubmed: 10048929
  • Hammen, P. K., Waygood, E. B., Klevit, R. E. (1991). "Reexamination of the secondary and tertiary structure of histidine-containing protein from Escherichia coli by homonuclear and heteronuclear NMR spectroscopy." Biochemistry 30:11842-11850. Pubmed: 1751501
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Jia, Z., Quail, J. W., Waygood, E. B., Delbaere, L. T. (1993). "The 2.0-A resolution structure of Escherichia coli histidine-containing phosphocarrier protein HPr. A redetermination." J Biol Chem 268:22490-22501. Pubmed: 8226757
  • Klevit, R. E., Waygood, E. B. (1986). "Two-dimensional 1H NMR studies of histidine-containing protein from Escherichia coli. 3. Secondary and tertiary structure as determined by NMR." Biochemistry 25:7774-7781. Pubmed: 3542036
  • Link, A. J., Robison, K., Church, G. M. (1997). "Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12." Electrophoresis 18:1259-1313. Pubmed: 9298646
  • Napper, S., Anderson, J. W., Georges, F., Quail, J. W., Delbaere, L. T., Waygood, E. B. (1996). "Mutation of serine-46 to aspartate in the histidine-containing protein of Escherichia coli mimics the inactivation by phosphorylation of serine-46 in HPrs from gram-positive bacteria." Biochemistry 35:11260-11267. Pubmed: 8784179
  • Saffen, D. W., Presper, K. A., Doering, T. L., Roseman, S. (1987). "Sugar transport by the bacterial phosphotransferase system. Molecular cloning and structural analysis of the Escherichia coli ptsH, ptsI, and crr genes." J Biol Chem 262:16241-16253. Pubmed: 2960675
  • van Dijk, A. A., de Lange, L. C., Bachovchin, W. W., Robillard, G. T. (1990). "Effect of phosphorylation on hydrogen-bonding interactions of the active site histidine of the phosphocarrier protein HPr of the phosphoenolpyruvate-dependent phosphotransferase system determined by 15N NMR spectroscopy." Biochemistry 29:8164-8171. Pubmed: 2261470
  • van Nuland, N. A., Boelens, R., Scheek, R. M., Robillard, G. T. (1995). "High-resolution structure of the phosphorylated form of the histidine-containing phosphocarrier protein HPr from Escherichia coli determined by restrained molecular dynamics from NMR-NOE data." J Mol Biol 246:180-193. Pubmed: 7853396
  • van Nuland, N. A., Grotzinger, J., Dijkstra, K., Scheek, R. M., Robillard, G. T. (1992). "Determination of the three-dimensional solution structure of the histidine-containing phosphocarrier protein HPr from Escherichia coli using multidimensional NMR spectroscopy." Eur J Biochem 210:881-891. Pubmed: 1483471
  • van Nuland, N. A., Hangyi, I. W., van Schaik, R. C., Berendsen, H. J., van Gunsteren, W. F., Scheek, R. M., Robillard, G. T. (1994). "The high-resolution structure of the histidine-containing phosphocarrier protein HPr from Escherichia coli determined by restrained molecular dynamics from nuclear magnetic resonance nuclear Overhauser effect data." J Mol Biol 237:544-559. Pubmed: 8158637
  • Van Nuland, N. A., Wiersma, J. A., Van Der Spoel, D., De Groot, B. L., Scheek, R. M., Robillard, G. T. (1996). "Phosphorylation-induced torsion-angle strain in the active center of HPr, detected by NMR and restrained molecular dynamics refinement." Protein Sci 5:442-446. Pubmed: 8868480
  • Wasinger, V. C., Humphery-Smith, I. (1998). "Small genes/gene-products in Escherichia coli K-12." FEMS Microbiol Lett 169:375-382. Pubmed: 9868784
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837