Thioredoxin-1 (P0AA25)

• Trx-1

>330 bp
ATGTTTGGTAAAGGCGGTCTGGGTAACCTGATGAAGCAAGCCCAGCAGATGCAAGAAAAA
ATGCAGAAAATGCAGGAAGAGATCGCGCAGCTGGAAGTCACCGGCGAATCTGGCGCAGGT
CTGGTAAAAGTGACCATCAACGGTGCACACAACTGCCGTCGCGTAGAGATCGACCCGAGC
CTGCTGGAAGACGACAAAGAGATGCTGGAAGACCTGGTGGCTGCAGCATTCAACGACGCA
GCACGTCGTATTGAAGAAACGCAGAAAGAAAAAATGGCCTCTGTATCCTCCGGAATGCAG
CTGCCGCCTGGCTTTAAGATGCCGTTCTGA

• Thioredoxin (PF00085 )

• None

• None

>Thioredoxin-1
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLN
IDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA

• Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
• Daniels, D. L., Plunkett, G. 3rd, Burland, V., Blattner, F. R. (1992). "Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes." Science 257:771-778. Pubmed: 1379743
• Dyson, H. J., Gippert, G. P., Case, D. A., Holmgren, A., Wright, P. E. (1990). "Three-dimensional solution structure of the reduced form of Escherichia coli thioredoxin determined by nuclear magnetic resonance spectroscopy." Biochemistry 29:4129-4136. Pubmed: 2193685
• Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
• Holmgren, A. (1968). "Thioredoxin. 6. The amino acid sequence of the protein from escherichia coli B." Eur J Biochem 6:475-484. Pubmed: 4883076
• Holmgren, A., Soderberg, B. O., Eklund, H., Branden, C. I. (1975). "Three-dimensional structure of Escherichia coli thioredoxin-S2 to 2.8 A resolution." Proc Natl Acad Sci U S A 72:2305-2309. Pubmed: 1094461
• Hoog, J. O., von Bahr-Lindstrom, H., Josephson, S., Wallace, B. J., Kushner, S. R., Jornvall, H., Holmgren, A. (1984). "Nucleotide sequence of the thioredoxin gene from Escherichia coli." Biosci Rep 4:917-923. Pubmed: 6098320
• Jeng, M. F., Campbell, A. P., Begley, T., Holmgren, A., Case, D. A., Wright, P. E., Dyson, H. J. (1994). "High-resolution solution structures of oxidized and reduced Escherichia coli thioredoxin." Structure 2:853-868. Pubmed: 7812718
• Katti, S. K., LeMaster, D. M., Eklund, H. (1990). "Crystal structure of thioredoxin from Escherichia coli at 1.68 A resolution." J Mol Biol 212:167-184. Pubmed: 2181145
• Lennon, B. W., Williams, C. H. Jr, Ludwig, M. L. (2000). "Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase." Science 289:1190-1194. Pubmed: 10947986
• Lim, C. J., Geraghty, D., Fuchs, J. A. (1985). "Cloning and nucleotide sequence of the trxA gene of Escherichia coli K-12." J Bacteriol 163:311-316. Pubmed: 3891733
• Nikkola, M., Gleason, F. K., Fuchs, J. A., Eklund, H. (1993). "Crystal structure analysis of a mutant Escherichia coli thioredoxin in which lysine 36 is replaced by glutamic acid." Biochemistry 32:5093-5098. Pubmed: 8098620
• Schultz, L. W., Chivers, P. T., Raines, R. T. (1999). "The CXXC motif: crystal structure of an active-site variant of Escherichia coli thioredoxin." Acta Crystallogr D Biol Crystallogr 55:1533-1538. Pubmed: 10489448
• Soderberg, B. O., Holmgren, A., Branden, C. I. (1974). "Structure of oxidized thioredoxin to 4 with 5 A resolution." J Mol Biol 90:143-152. Pubmed: 4616096
• Wallace, B. J., Kushner, S. R. (1984). "Genetic and physical analysis of the thioredoxin (trxA) gene of Escherichia coli K-12." Gene 32:399-408. Pubmed: 6099324
• Zhang, J., Sprung, R., Pei, J., Tan, X., Kim, S., Zhu, H., Liu, C. F., Grishin, N. V., Zhao, Y. (2009). "Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli." Mol Cell Proteomics 8:215-225. Pubmed: 18723842