Maltose/maltodextrin import ATP-binding protein MalK (P68187)

• 3.6.3.19

• Starch and sucrose metabolism PW000941

• ABC transporters ec02010
• Starch and sucrose metabolism ec00500

>1116 bp
ATGTTCCCAAAAATAATGAATGATGAAAACTTTTTCAAAAAAGCGGCGGCGCACGGGGAG
GAACCTCCTTTAACTCCTCAAAACGAACATCAGCGGTCCGGGCTGCGCTTCGCCCGTCGC
GTCAGACTACCCCGTGCGGTTGGCCTGGCTGGCATGTTCTTACCGATTGCTTCAACGCTG
GTTTCACACCCGCCGCCGGGCTGGTGGTGGCTGGTGTTGGTCGGCTGGGCGTTCGTCTGG
CCGCATTTAGCCTGGCAGATAGCGAGCAGGGCCGTCGATCCGCTTAGCCGGGAAATTTAC
AACTTAAAAACCGATGCAGTATTAGCGGGAATGTGGGTAGGCGTAATGGGCGTAAACGTG
CTGCCTTCCACCGCGATGTTGATGATTATGTGTCTGAATTTGATGGGGGCAGGCGGCCCC
CGTCTGTTTGTCGCGGGTCTGGTGTTGATGGTGGTTTCCTGCCTTGTCACCCTCGAGCTG
ACGGGCATTACCGTGTCGTTCAATAGTGCGCCGCTGGAATGGTGGCTCTCCCTTCCCATT
ATTGTCATTTATCCTCTGCTGTTTGGCTGGGTCAGCTACCAGACGGCAACCAAACTGGCG
GAACATAAACGCAGGTTGCAGGTCATGAGTACCCGCGACGGCATGACGGGCGTGTATAAC
CGACGTCATTGGGAAACTATGTTACGCAATGAATTTGATAACTGTCGGCGGCATAATCGC
GATGCAACGTTACTGATTATCGATATCGACCATTTCAAGAGCATCAACGATACCTGGGGC
CATGATGTGGGCGATGAAGCGATTGTGGCGCTTACCCGACAGTTACAAATTACCCTGCGC
GGTAGCGATGTGATTGGTCGGTTTGGCGGCGATGAGTTTGCAGTAATCATGTCCGGTACG
CCAGCTGAGAGCGCCATTACCGCCATGTTACGGGTGCATGAAGGGCTAAATACATTACGT
TTGCCGAATACGCCACAGGTAACTTTACGGATTAGTGTGGGGGTTGCGCCGCTGAACCCA
CAAATGAGTCACTATCGTGAGTGGTTGAAATCGGCAGATTTGGCGCTTTACAAAGCAAAG
AAAGCCGGACGTAACCGCACCGAAGTGGCGGCCTGA

• ABC_tran (PF00005 )
• TOBE_2 (PF08402 )

• None

• None

>Maltose/maltodextrin import ATP-binding protein MalK
MASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDL
FIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEV
LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLH
KRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMN
FLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVIL
EGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGT
ACRRLHKEPGV

• Bedouelle, H., Hofnung, M. (1982). "A DNA sequence containing the control regions of the malEFG and malK-lamB operons in Escherichia coli K12." Mol Gen Genet 185:82-87. Pubmed: 6283312
• Blattner, F. R., Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L. (1993). "Analysis of the Escherichia coli genome. IV. DNA sequence of the region from 89.2 to 92.8 minutes." Nucleic Acids Res 21:5408-5417. Pubmed: 8265357
• Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
• Bohm, A., Diez, J., Diederichs, K., Welte, W., Boos, W. (2002). "Structural model of MalK, the ABC subunit of the maltose transporter of Escherichia coli: implications for mal gene regulation, inducer exclusion, and subunit assembly." J Biol Chem 277:3708-3717. Pubmed: 11709552
• Boos, W., Shuman, H. (1998). "Maltose/maltodextrin system of Escherichia coli: transport, metabolism, and regulation." Microbiol Mol Biol Rev 62:204-229. Pubmed: 9529892
• Chen, J., Lu, G., Lin, J., Davidson, A. L., Quiocho, F. A. (2003). "A tweezers-like motion of the ATP-binding cassette dimer in an ABC transport cycle." Mol Cell 12:651-661. Pubmed: 14527411
• Dahl, M. K., Francoz, E., Saurin, W., Boos, W., Manson, M. D., Hofnung, M. (1989). "Comparison of sequences from the malB regions of Salmonella typhimurium and Enterobacter aerogenes with Escherichia coli K12: a potential new regulatory site in the interoperonic region." Mol Gen Genet 218:199-207. Pubmed: 2674653
• Davidson, A. L., Nikaido, H. (1990). "Overproduction, solubilization, and reconstitution of the maltose transport system from Escherichia coli." J Biol Chem 265:4254-4260. Pubmed: 2155217
• Davidson, A. L., Nikaido, H. (1991). "Purification and characterization of the membrane-associated components of the maltose transport system from Escherichia coli." J Biol Chem 266:8946-8951. Pubmed: 2026607
• Dean, D. A., Reizer, J., Nikaido, H., Saier, M. H. Jr (1990). "Regulation of the maltose transport system of Escherichia coli by the glucose-specific enzyme III of the phosphoenolpyruvate-sugar phosphotransferase system. Characterization of inducer exclusion-resistant mutants and reconstitution of inducer exclusion in proteoliposomes." J Biol Chem 265:21005-21010. Pubmed: 2250006
• Gilson, E., Nikaido, H., Hofnung, M. (1982). "Sequence of the malK gene in E.coli K12." Nucleic Acids Res 10:7449-7458. Pubmed: 6296778
• Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
• Hunke, S., Mourez, M., Jehanno, M., Dassa, E., Schneider, E. (2000). "ATP modulates subunit-subunit interactions in an ATP-binding cassette transporter (MalFGK2) determined by site-directed chemical cross-linking." J Biol Chem 275:15526-15534. Pubmed: 10809785
• Kuhnau, S., Reyes, M., Sievertsen, A., Shuman, H. A., Boos, W. (1991). "The activities of the Escherichia coli MalK protein in maltose transport, regulation, and inducer exclusion can be separated by mutations." J Bacteriol 173:2180-2186. Pubmed: 2007546
• Mourez, M., Hofnung, M., Dassa, E. (1997). "Subunit interactions in ABC transporters: a conserved sequence in hydrophobic membrane proteins of periplasmic permeases defines an important site of interaction with the ATPase subunits." EMBO J 16:3066-3077. Pubmed: 9214624
• Panagiotidis, C. H., Boos, W., Shuman, H. A. (1998). "The ATP-binding cassette subunit of the maltose transporter MalK antagonizes MalT, the activator of the Escherichia coli mal regulon." Mol Microbiol 30:535-546. Pubmed: 9822819
• Stenberg, F., Chovanec, P., Maslen, S. L., Robinson, C. V., Ilag, L. L., von Heijne, G., Daley, D. O. (2005). "Protein complexes of the Escherichia coli cell envelope." J Biol Chem 280:34409-34419. Pubmed: 16079137