| Identification |
|---|
| Name: | Biopolymer transport protein exbD |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | exbD |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | Involved in transporter activity |
|---|
| Specific Function: | Involved in the tonB-dependent energy-dependent transport of various receptor-bound substrates |
|---|
| Cellular Location: | Cell inner membrane; Single-pass type II membrane protein |
|---|
| SMPDB Pathways: | - Biosynthesis of siderophore group nonribosomal peptides PW000760
- adenosylcobalamin salvage from cobinamide PW001884
|
|---|
| KEGG Pathways: | - Biosynthesis of siderophore group nonribosomal peptides ec01053
|
|---|
| Transports: | |
|---|
| Transport References: | - Orth, J. D., Conrad, T. M., Na, J., Lerman, J. A., Nam, H., Feist, A. M., Palsson, B. O. (2011). "A comprehensive genome-scale reconstruction of Escherichia coli metabolism--2011." Mol Syst Biol 7:535. Pubmed: 21988831
|
|---|
| Metabolites: | |
|---|
| GO Classification: | | Component |
|---|
| cell part | | membrane | | Function |
|---|
| transporter activity | | Process |
|---|
| establishment of localization | | transport |
|
|---|
| Gene Properties |
|---|
| Blattner: | b3005 |
|---|
| Gene Orientation | Counterclockwise |
|---|
| Centisome Percentage: | 67.87 |
|---|
| Left Sequence End | 3148840 |
|---|
| Right Sequence End | 3149265 |
|---|
| Gene Sequence: | >426 bp
GTGGCCACTCTCTGCCATGTGTTCGGGGTTCATCGCAGCAGCTACAAATACTGGAAAAAC
CGTCCTGAAAAGCCAGACGGCAGACGGGCTGTATTACGCAGTCAGGTACTTGAACTGCAT
GGCATCAGCCACGGCTCTGCCGGAGCAAGAAGCATCGCCACAATGGCAACCCAGAGAGGA
TACCAGATGGGGCGCTGGCTTGCTGGCAGACTCATGAAAGAGCTGGGGCTGGTCAGTTGC
CAGCAGCCGACTCACCGGTATAAGCGTGGCGGTCATGAGCACGTTGCTATCCCGAATCAT
CTTGAGCGACAGTTCGCCGTAACGGAACCAAATCAGGTGTGGTGCGGTGATGTGACCTAT
AGTGTGCCCGGAGTTCAGGGCGGGCATGGATGCTTAAATGAACCGCGAGTCTGTCTGGAA
TATTGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 141 |
|---|
| Protein Molecular Weight: | 15527 |
|---|
| Protein Theoretical pI: | 4 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Biopolymer transport protein exbD
MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRP
EKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMD
TLHQAGYLKIGLVGEETAKAK |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Eick-Helmerich, K., Braun, V. (1989). "Import of biopolymers into Escherichia coli: nucleotide sequences of the exbB and exbD genes are homologous to those of the tolQ and tolR genes, respectively." J Bacteriol 171:5117-5126. Pubmed: 2670903
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Kampfenkel, K., Braun, V. (1992). "Membrane topology of the Escherichia coli ExbD protein." J Bacteriol 174:5485-5487. Pubmed: 1644779
|
|---|