Identification |
---|
Name: | Biopolymer transport protein exbD |
---|
Synonyms: | Not Available |
---|
Gene Name: | exbD |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | Involved in transporter activity |
---|
Specific Function: | Involved in the tonB-dependent energy-dependent transport of various receptor-bound substrates |
---|
Cellular Location: | Cell inner membrane; Single-pass type II membrane protein |
---|
SMPDB Pathways: | - Biosynthesis of siderophore group nonribosomal peptides PW000760
- adenosylcobalamin salvage from cobinamide PW001884
|
---|
KEGG Pathways: | - Biosynthesis of siderophore group nonribosomal peptides ec01053
|
---|
Transports: | |
---|
Transport References: | - Orth, J. D., Conrad, T. M., Na, J., Lerman, J. A., Nam, H., Feist, A. M., Palsson, B. O. (2011). "A comprehensive genome-scale reconstruction of Escherichia coli metabolism--2011." Mol Syst Biol 7:535. Pubmed: 21988831
|
---|
Metabolites: | |
---|
GO Classification: | Component |
---|
cell part | membrane | Function |
---|
transporter activity | Process |
---|
establishment of localization | transport |
|
---|
Gene Properties |
---|
Blattner: | b3005 |
---|
Gene Orientation | Counterclockwise |
---|
Centisome Percentage: | 67.87 |
---|
Left Sequence End | 3148840 |
---|
Right Sequence End | 3149265 |
---|
Gene Sequence: | >426 bp
GTGGCCACTCTCTGCCATGTGTTCGGGGTTCATCGCAGCAGCTACAAATACTGGAAAAAC
CGTCCTGAAAAGCCAGACGGCAGACGGGCTGTATTACGCAGTCAGGTACTTGAACTGCAT
GGCATCAGCCACGGCTCTGCCGGAGCAAGAAGCATCGCCACAATGGCAACCCAGAGAGGA
TACCAGATGGGGCGCTGGCTTGCTGGCAGACTCATGAAAGAGCTGGGGCTGGTCAGTTGC
CAGCAGCCGACTCACCGGTATAAGCGTGGCGGTCATGAGCACGTTGCTATCCCGAATCAT
CTTGAGCGACAGTTCGCCGTAACGGAACCAAATCAGGTGTGGTGCGGTGATGTGACCTAT
AGTGTGCCCGGAGTTCAGGGCGGGCATGGATGCTTAAATGAACCGCGAGTCTGTCTGGAA
TATTGA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 141 |
---|
Protein Molecular Weight: | 15527 |
---|
Protein Theoretical pI: | 4 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Biopolymer transport protein exbD
MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRP
EKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMD
TLHQAGYLKIGLVGEETAKAK |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Eick-Helmerich, K., Braun, V. (1989). "Import of biopolymers into Escherichia coli: nucleotide sequences of the exbB and exbD genes are homologous to those of the tolQ and tolR genes, respectively." J Bacteriol 171:5117-5126. Pubmed: 2670903
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Kampfenkel, K., Braun, V. (1992). "Membrane topology of the Escherichia coli ExbD protein." J Bacteriol 174:5485-5487. Pubmed: 1644779
|
---|