Identification |
---|
Name: | Xanthine dehydrogenase iron-sulfur-binding subunit |
---|
Synonyms: | Not Available |
---|
Gene Name: | xdhC |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | Involved in oxidoreductase activity |
---|
Specific Function: | Iron-sulfur subunit of the xanthine dehydrogenase complex |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | - adenosine nucleotides degradation PW002091
|
---|
KEGG Pathways: | |
---|
KEGG Reactions: | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00157/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00902/thumb.png) | → | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01487/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00292/thumb.png) |
| | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00902/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00292/thumb.png) | ↔ | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01487/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00289/thumb.png) |
| | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00157/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00902/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | ↔ | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00292/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01487/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) |
| |
|
---|
EcoCyc Reactions: | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00157/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00902/thumb.png) | → | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01487/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00292/thumb.png) |
| | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00902/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00292/thumb.png) | ↔ | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01487/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00289/thumb.png) |
| | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00292/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00902/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | → | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00289/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01487/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) |
| |
|
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
binding | catalytic activity | cation binding | electron carrier activity | ion binding | iron-sulfur cluster binding | metal cluster binding | metal ion binding | oxidoreductase activity | Process |
---|
metabolic process | oxidation reduction |
|
---|
Gene Properties |
---|
Blattner: | b2868 |
---|
Gene Orientation | Clockwise |
---|
Centisome Percentage: | 64.69 |
---|
Left Sequence End | 3001511 |
---|
Right Sequence End | 3001990 |
---|
Gene Sequence: | >480 bp
ATGATCAGTCTGATTGCGGCGTTAGCGGTAGATCGCGTTATCGGCATGGAAAACGCCATG
CCGTGGAACCTGCCTGCCGATCTCGCCTGGTTTAAACGCAACACCTTAAATAAACCCGTG
ATTATGGGCCGCCATACCTGGGAATCAATCGGTCGTCCGTTGCCAGGACGCAAAAATATT
ATCCTCAGCAGTCAACCGGGTACGGACGATCGCGTAACGTGGGTGAAGTCGGTGGATGAA
GCCATCGCGGCGTGTGGTGACGTACCAGAAATCATGGTGATTGGCGGCGGTCGCGTTTAT
GAACAGTTCTTGCCAAAAGCGCAAAAACTGTATCTGACGCATATCGACGCAGAAGTGGAA
GGCGACACCCATTTCCCGGATTACGAGCCGGATGACTGGGAATCGGTATTCAGCGAATTC
CACGATGCTGATGCGCAGAACTCTCACAGCTATTGCTTTGAGATTCTGGAGCGGCGGTAA
|
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 159 |
---|
Protein Molecular Weight: | 16922 |
---|
Protein Theoretical pI: | 7 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Xanthine dehydrogenase iron-sulfur-binding subunit
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Xi, H., Schneider, B. L., Reitzer, L. (2000). "Purine catabolism in Escherichia coli and function of xanthine dehydrogenase in purine salvage." J Bacteriol 182:5332-5341. Pubmed: 10986234
|
---|