Identification |
---|
Name: | D-methionine transport system permease protein metI |
---|
Synonyms: | Not Available |
---|
Gene Name: | metI |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | Involved in transporter activity |
---|
Specific Function: | Part of the binding-protein-dependent transport system for D-methionine and the toxic methionine analog alpha-methyl- methionine. Probably responsible for the translocation of the substrate across the membrane |
---|
Cellular Location: | Cell inner membrane; Multi-pass membrane protein |
---|
SMPDB Pathways: | |
---|
KEGG Pathways: | |
---|
Transports: | |
---|
Transport References: | - Uniprot Consortium (2012). "Reorganizing the protein space at the Universal Protein Resource (UniProt)." Nucleic Acids Res 40:D71-D75. Pubmed: 22102590
|
---|
SMPDB Reactions: | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00696/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00538/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | → | 1.0Adenosine diphosphate | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01429/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00696/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01341/thumb.png) |
| | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00696/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00538/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | → | 1.0Adenosine diphosphate | + | 1.0Pyrophosphate | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00696/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01341/thumb.png) |
| |
|
---|
EcoCyc Reactions: | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00538/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00696/thumb.png) | → | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01341/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00696/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01429/thumb.png) |
| | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00538/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21203/thumb.png) | → | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01341/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21203/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01429/thumb.png) |
| |
|
---|
Metabolites: | |
---|
GO Classification: | Component |
---|
cell part | membrane | Function |
---|
transporter activity | Process |
---|
establishment of localization | transport |
|
---|
Gene Properties |
---|
Blattner: | b0198 |
---|
Gene Orientation | Counterclockwise |
---|
Centisome Percentage: | 4.76 |
---|
Left Sequence End | 220968 |
---|
Right Sequence End | 221621 |
---|
Gene Sequence: | >654 bp
ATGTCTGAGCCGATGATGTGGCTGCTGGTTCGTGGCGTATGGGAAACGCTGGCAATGACC
TTCGTATCCGGTTTTTTTGGCTTTGTGATTGGTCTGCCGGTTGGCGTTCTGCTTTATGTC
ACGCGTCCGGGGCAAATTATTGCTAACGCGAAGCTGTATCGTACCGTTTCTGCGATTGTG
AACATTTTCCGTTCCATCCCGTTCATTATCTTGCTTGTATGGATGATTCCGTTTACCCGC
GTTATTGTCGGTACATCGATTGGTTTGCAGGCAGCGATTGTTCCGTTAACCGTTGGTGCA
GCACCGTTTATTGCCCGTATGGTCGAGAACGCTCTGCTGGAGATCCCAACCGGGTTAATT
GAAGCTTCCCGCGCAATGGGTGCCACGCCGATGCAGATCGTCCGTAAGGTGCTGTTACCG
GAAGCGCTGCCGGGTCTGGTGAATGCGGCAACTATCACCCTGATTACCCTGGTCGGTTAT
TCCGCGATGGGTGGTGCAGTCGGTGCCGGTGGTTTAGGTCAGATTGGCTATCAGTATGGC
TACATCGGCTATAACGCGACGGTGATGAATACGGTACTGGTATTGCTGGTCATTCTGGTT
TATTTAATTCAGTTCGCAGGCGACCGCATCGTCCGGGCTGTCACTCGCAAGTAA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 217 |
---|
Protein Molecular Weight: | 23256 |
---|
Protein Theoretical pI: | 10 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | - 20-40
- 58-78
- 81-101
- 152-172
- 186-206
|
---|
Protein Sequence: | >D-methionine transport system permease protein metI
MSEPMMWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTRPGQIIANAKLYRTVSAIV
NIFRSIPFIILLVWMIPFTRVIVGTSIGLQAAIVPLTVGAAPFIARMVENALLEIPTGLI
EASRAMGATPMQIVRKVLLPEALPGLVNAATITLITLVGYSAMGGAVGAGGLGQIGYQYG
YIGYNATVMNTVLVLLVILVYLIQFAGDRIVRAVTRK |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
- Gal, J., Szvetnik, A., Schnell, R., Kalman, M. (2002). "The metD D-methionine transporter locus of Escherichia coli is an ABC transporter gene cluster." J Bacteriol 184:4930-4932. Pubmed: 12169620
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
|
---|