| Identification |
|---|
| Name: | Uncharacterized protein ygfA |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | ygfA |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | Involved in ATP binding |
|---|
| Specific Function: | Specific function unknown |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | |
|---|
| KEGG Pathways: | |
|---|
| KEGG Reactions: | |
|---|
| EcoCyc Reactions: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| 5-formyltetrahydrofolate cyclo-ligase activity | | adenyl nucleotide binding | | adenyl ribonucleotide binding | | ATP binding | | binding | | catalytic activity | | cyclo-ligase activity | | ligase activity | | ligase activity, forming carbon-nitrogen bonds | | nucleoside binding | | purine nucleoside binding | | Process |
|---|
| cellular aromatic compound metabolic process | | cellular metabolic process | | folic acid and derivative biosynthetic process | | folic acid and derivative metabolic process | | metabolic process |
|
|---|
| Gene Properties |
|---|
| Blattner: | b2912 |
|---|
| Gene Orientation | Clockwise |
|---|
| Centisome Percentage: | 65.83 |
|---|
| Left Sequence End | 3054263 |
|---|
| Right Sequence End | 3054811 |
|---|
| Gene Sequence: | >549 bp
ATGGACAAATTCGACGCTAATCGCCGCAAATTGCTGGCGCTTGGTGGCGTTGCACTCGGT
GCCGCCATCCTGCCGACCCCTGCGTTTGCAACACTCTCTACCCCACGCCCGCGCATTTTG
ACACTCAATAATCTTCATACCGGAGAGTCAATCAAAGCGGAGTTTTTCGATGGCAGAGGC
TATATTCAGGAAGAATTGGCAAAACTTAACCATTTTTTCCGCGATTACCGCGCGAACAAA
ATAAAGTCCATCGACCCAGGATTATTCGACCAGTTGTATCGCCTGCAAGGGTTGTTAGGC
ACGCGCAAACCGGTGCAACTCATTTCCGGTTATCGTTCTATTGATACCAACAATGAACTA
CGCGCCCGCAGCCGTGGAGTAGCGAAGAAAAGCTATCACACTAAAGGCCAGGCGATGGAT
TTCCATATTGAAGGTATCGCGTTAAGCAATATTCGCAAAGCCGCGTTATCTATGCGCGCA
GGTGGTGTAGGATATTATCCACGTAGTAACTTTGTGCATATTGATACCGGGCCAGCACGG
CACTGGTAG |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 182 |
|---|
| Protein Molecular Weight: | 21105 |
|---|
| Protein Theoretical pI: | 7 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Uncharacterized protein ygfA
MIRQRRRALTPEQQQEMGQQAATRMMTYPPVVMAHTVAVFLSFDGELDTQPLIEQLWRAG
KRVYLPVLHPFSAGNLLFLNYHPQSELVMNRLKIHEPKLDVRDVLPLSRLDVLITPLVAF
DEYGQRLGMGGGFYDRTLQNWQHYKTQPVGYAHDCQLVEKLPVEEWDIPLPAVVTPSKVW
EW |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Hsu, L. M., Zagorski, J., Wang, Z., Fournier, M. J. (1985). "Escherichia coli 6S RNA gene is part of a dual-function transcription unit." J Bacteriol 161:1162-1170. Pubmed: 2579060
|
|---|