Autonomous glycyl radical cofactor (P68066)

Identification
Name:Autonomous glycyl radical cofactor
Synonyms:Not Available
Gene Name:grcA
Enzyme Class:Not Available
Biological Properties
General Function:Involved in catalytic activity
Specific Function:Acts as a radical domain for damaged PFL and possibly other radical proteins
Cellular Location:Not Available
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
KEGG Reactions:
1.0Thumb+1.0Thumb ↔ 1.0Thumb+1.0Thumb
1.0Coenzyme A + 1.0Pyruvic acid ↔ 1.0Acetyl-CoA + 1.0Formic acid
ReactionCard
EcoCyc Reactions:
1.0Thumb+1.0Thumb ↔ 1.0Thumb+1.0Thumb
1.0Coenzyme A + 1.0Pyruvic acid ↔ 1.0Acetyl-CoA + 1.0Formic acid
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB000052-Ketobutyric acidMetaboCard
ECMDB01206Acetyl-CoAMetaboCard
ECMDB01423Coenzyme AMetaboCard
ECMDB00142Formic acidMetaboCard
ECMDB01275Propionyl-CoAMetaboCard
ECMDB00243Pyruvic acidMetaboCard
GO Classification:
Function
catalytic activity
Process
metabolic process
Gene Properties
Blattner:b2579
Gene OrientationCounterclockwise
Centisome Percentage:58.50
Left Sequence End2714088
Right Sequence End2714471
Gene Sequence:
>384 bp
ATGCGTGATATTCAGATGGTTCTTGAGCGTTGGGGAGCGTGGGCGGCTAATAATCATGAA
GATGTGACCTGGTCGTCCATTGCCGCCGGTTTTAAGGGATTAATTACTTCAAAAGTAAAA
TCTCGCCCGCAATGTTGTGACGATGACGCGATGATCATTTGCGGGTGCATGGCCCGTCTG
AAAAAGAACAACAGCGATTTGCACGATTTATTAGTAGATTATTATGTAGTCGGTATGACA
TTCATGTCACTGGCAGGTAAGCATTGCTGCTCTGATGGTTATATCGGGAAAAGGTTACAG
AAGGCTGAGGGCATAATTGAAGGGATGTTAATGGCATTAGATATCCGGTTAGAGATGGAT
ATCGTTGTTAATAACTCTAATTAA
Protein Properties
Pfam Domain Function:
Protein Residues:127
Protein Molecular Weight:14284
Protein Theoretical pI:5
Signaling Regions:
  • None
Transmembrane Regions:
  • None
Protein Sequence:
>Autonomous glycyl radical cofactor
MITGIQITKAANDDLLNSFWLLDSEKGEARCIVAKAGYAEDEVVAVSKLGDIEYREVPVE
VKPEVRVEGGQHLNVNVLRRETLEDAVKHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIA
RTFTESL
References
External Links:
ResourceLink
Uniprot ID:P68066
Uniprot Name:GRCA_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674687
Ecogene ID:EG11784
Ecocyc:EG11784
ColiBase:b2579
Kegg Gene:b2579
EchoBASE ID:EB1732
CCDB:GRCA_ECOLI
BacMap:16130504
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Borodovsky, M., Rudd, K. E., Koonin, E. V. (1994). "Intrinsic and extrinsic approaches for detecting genes in a bacterial genome." Nucleic Acids Res 22:4756-4767. Pubmed: 7984428
  • Fountoulakis, M., Takacs, M. F., Berndt, P., Langen, H., Takacs, B. (1999). "Enrichment of low abundance proteins of Escherichia coli by hydroxyapatite chromatography." Electrophoresis 20:2181-2195. Pubmed: 10493123
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Varshney, U., Hutcheon, T., van de Sande, J. H. (1988). "Sequence analysis, expression, and conservation of Escherichia coli uracil DNA glycosylase and its gene (ung)." J Biol Chem 263:7776-7784. Pubmed: 2836397
  • Wagner, A. F., Schultz, S., Bomke, J., Pils, T., Lehmann, W. D., Knappe, J. (2001). "YfiD of Escherichia coli and Y06I of bacteriophage T4 as autonomous glycyl radical cofactors reconstituting the catalytic center of oxygen-fragmented pyruvate formate-lyase." Biochem Biophys Res Commun 285:456-462. Pubmed: 11444864
  • Wasinger, V. C., Humphery-Smith, I. (1998). "Small genes/gene-products in Escherichia coli K-12." FEMS Microbiol Lett 169:375-382. Pubmed: 9868784
  • Wilkins, M. R., Gasteiger, E., Tonella, L., Ou, K., Tyler, M., Sanchez, J. C., Gooley, A. A., Walsh, B. J., Bairoch, A., Appel, R. D., Williams, K. L., Hochstrasser, D. F. (1998). "Protein identification with N and C-terminal sequence tags in proteome projects." J Mol Biol 278:599-608. Pubmed: 9600841
  • Wyborn, N. R., Messenger, S. L., Henderson, R. A., Sawers, G., Roberts, R. E., Attwood, M. M., Green, J. (2002). "Expression of the Escherichia coli yfiD gene responds to intracellular pH and reduces the accumulation of acidic metabolic end products." Microbiology 148:1015-1026. Pubmed: 11932447
  • Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837
  • Zhang, J., Sprung, R., Pei, J., Tan, X., Kim, S., Zhu, H., Liu, C. F., Grishin, N. V., Zhao, Y. (2009). "Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli." Mol Cell Proteomics 8:215-225. Pubmed: 18723842