Identification |
---|
Name: | Cytochrome c biogenesis ATP-binding export protein CcmA |
---|
Synonyms: | |
---|
Gene Name: | ccmA |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | Involved in nucleotide binding |
---|
Specific Function: | Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system |
---|
Cellular Location: | Cell inner membrane; Peripheral membrane protein |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | |
---|
EcoCyc Reactions: | |
1.0 | + | 1.0 | + | 1.0 | → | 1.0 | + | 1.0 | + | 1.0 | + | 1.0 |
| |
|
---|
Complex Reactions: | |
1.0 | + | 1.0 | + | 1.0heme(In) | → | 1.0 | + | 1.0 | + | 1.0heme(Out) |
| |
|
---|
Metabolites: | |
---|
GO Classification: | Component |
---|
cell part | outer membrane-bounded periplasmic space | periplasmic space | Function |
---|
adenyl nucleotide binding | adenyl ribonucleotide binding | ATP binding | ATPase activity | binding | catalytic activity | hydrolase activity | hydrolase activity, acting on acid anhydrides | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | nucleoside binding | nucleoside-triphosphatase activity | nucleotide binding | purine nucleoside binding | pyrophosphatase activity | transporter activity | Process |
---|
cellular component assembly | cellular component organization | cellular component organization or biogenesis | cellular protein complex assembly | cytochrome complex assembly | macromolecular complex assembly | protein complex assembly |
|
---|
Gene Properties |
---|
Blattner: | b2201 |
---|
Gene Orientation | Counterclockwise |
---|
Centisome Percentage: | 49.47 |
---|
Left Sequence End | 2295043 |
---|
Right Sequence End | 2295666 |
---|
Gene Sequence: | >624 bp
ATGTCAGGTCTGCCACAGGGCAGACCAACGTTTGGCGCTGCGCAAAACGTGAGCGCGGTG
GTGGCGTATGACTTATCTGCCCACATGCTGGATGTCGTGGCACAAGCTGCCGAAGCCCGG
CAACTGAAAAATATCACCACCCGCCAGGGATATGCCGAAAGTCTGCCATTTGCCGATAAC
GCATTTGATATTGTTATCAGCCGTTATTCTGCCCATCACTGGCATGATGTTGGTGCAGCA
CTGCGAGAAGTGAATAGGATATTGAAACCTGGCGGTAGGCTGATTGTGATGGACGTAATG
TCTCCGGGTCACCCAGTGCGCGACATCTGGTTACAGACGGTAGAAGCATTACGCGATACC
TCTCACGTACGAAACTACGCCAGCGGTGAGTGGTTGACGTTAATCAATGAAGCCAATCTG
ATAGTTGATAATTTAATTACAGATAAGTTACCGCTGGAATTTTCTTCATGGGTCGCGAGA
ATGCGTACGCCAGAAGCGTTAGTAGACGCTATTCGCATTTACCAACAGAGCGCATCGACA
GAGGTGAGAACGTATTTTGCCTTGCAGAATGATGGCTTTTTCACCAGTGATATCATCATG
GTAGATGCACATAAAGCGGCATAA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 207 |
---|
Protein Molecular Weight: | 23053 |
---|
Protein Theoretical pI: | 7 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Cytochrome c biogenesis ATP-binding export protein CcmA
MGMLEARELLCERDERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEV
LWQGQPLHQVRDSYHQNLLWIGHQPGIKTRLTALENLHFYHRDGDTAQCLEALAQAGLAG
FEDIPVNQLSAGQQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTEQGGI
VILTTHQPLNVAESKIRRISLTQTRAA |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Cook, G. M., Poole, R. K. (2000). "Oxidase and periplasmic cytochrome assembly in Escherichia coli K-12: CydDC and CcmAB are not required for haem-membrane association." Microbiology 146 ( Pt 2):527-536. Pubmed: 10708391
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Schulz, H., Fabianek, R. A., Pellicioli, E. C., Hennecke, H., Thony-Meyer, L. (1999). "Heme transfer to the heme chaperone CcmE during cytochrome c maturation requires the CcmC protein, which may function independently of the ABC-transporter CcmAB." Proc Natl Acad Sci U S A 96:6462-6467. Pubmed: 10339610
- Thony-Meyer, L., Fischer, F., Kunzler, P., Ritz, D., Hennecke, H. (1995). "Escherichia coli genes required for cytochrome c maturation." J Bacteriol 177:4321-4326. Pubmed: 7635817
|
---|