| Identification |
|---|
| Name: | Nickel import ATP-binding protein NikD |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | nikD |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | Involved in nucleotide binding |
|---|
| Specific Function: | Part of the ABC transporter complex NikABCDE involved in nickel import. Responsible for energy coupling to the transport system |
|---|
| Cellular Location: | Cell inner membrane; Peripheral membrane protein |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Complex Reactions: | |
1.0 | + | 1.0 | + | 1.0 | → | 1.0 | + | 1.0 | + | 1.0 | + | 1.0 |
| | |
1.0 | + | 1.0 | + | 1.0Ni(2+)(Out) | → | 1.0 | + | 1.0 | + | 1.0Ni(2+)(In) |
| | |
1.0 | + | 1.0 | + | 1.0 | → | 1.0 | + | 1.0 | + | 1.0 |
| |
|
|---|
| Metabolites: | |
|---|
| GO Classification: | | Component |
|---|
| cell part | | membrane | | plasma membrane | | Function |
|---|
| adenyl nucleotide binding | | adenyl ribonucleotide binding | | ATP binding | | ATPase activity | | binding | | catalytic activity | | cation binding | | cation transmembrane transporter activity | | di-, tri-valent inorganic cation transmembrane transporter activity | | hydrolase activity | | hydrolase activity, acting on acid anhydrides | | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | | inorganic cation transmembrane transporter activity | | ion binding | | ion transmembrane transporter activity | | metal ion binding | | nickel ion binding | | nickel ion transmembrane transporter activity | | nickel-transporting ATPase activity | | nucleoside binding | | nucleoside-triphosphatase activity | | nucleotide binding | | purine nucleoside binding | | pyrophosphatase activity | | substrate-specific transmembrane transporter activity | | transition metal ion binding | | transmembrane transporter activity | | transporter activity | | Process |
|---|
| cation transport | | establishment of localization | | ion transport | | metal ion transport | | nickel ion transport | | transition metal ion transport | | transport |
|
|---|
| Gene Properties |
|---|
| Blattner: | b3479 |
|---|
| Gene Orientation | Clockwise |
|---|
| Centisome Percentage: | 77.92 |
|---|
| Left Sequence End | 3615038 |
|---|
| Right Sequence End | 3615802 |
|---|
| Gene Sequence: | >765 bp
ATGCAAGCATTGCTGGAACACTTTATTACCCAATCCACCGTGTATTCATTGATGGCGGTG
GTGTTGGTGGCCTTTCTGGAGTCGCTGGCGCTGGTCGGTTTGATTCTACCCGGTACGGTG
CTGATGGCGGGGCTGGGAGCGCTGATTGGCAGCGGCGAGTTAAGTTTCTGGCACGCCTGG
CTGGCAGGGATTATTGGCTGCTTGATGGGCGACTGGATTTCTTTCTGGCTGGGTTGGCGT
TTTAAAAAGCCGTTGCATCGCTGGTCATTTCTGAAGAAAAACAAAGCACTACTTGATAAA
ACTGAACATGCGTTGCATCAACACAGCATGTTCACCATTCTGGTCGGTCGTTTTGTTGGC
CCGACGCGTCCGCTGGTGCCAATGGTGGCGGGAATGCTGGATCTGCCGGTGGCTAAATTT
ATTACGCCGAATATTATCGGCTGCCTGCTGTGGCCGCCGTTTTACTTCCTGCCAGGGATT
CTGGCGGGCGCGGCGATCGATATTCCTGCCGGAATGCAGAGCGGTGAGTTTAAATGGTTG
CTGCTGGCAACAGCGGTGTTTTTGTGGGTTGGTGGCTGGCTGTGCTGGCGGTTATGGCGC
AGCGGTAAAGCGACTGACCGTTTGAGTCATTATTTGTCCCGCGGTCGTTTGTTGTGGCTG
ACGCCGTTGATTTCTGCCATCGGCGTGGTGGCGCTGGTGGTGTTAATTCGCCACCCGTTG
ATGCCGGTGTATATCGATATTTTGCGTAAAGTGGTTGGGGTTTAG |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 254 |
|---|
| Protein Molecular Weight: | 26820 |
|---|
| Protein Theoretical pI: | 6 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Nickel import ATP-binding protein NikD
MPQQIELRNIALQAAQPLVHGVSLTLQRGRVLALVGGSGSGKSLTCAATLGILPAGVRQT
AGEILADGKPVSPCALRGIKIATIMQNPRSAFNPLHTMHTHARETCLALGKPADDATLTA
AIEAVGLENAARVLKLYPFEMSGGMLQRMMIAMAVLCESPFIIADEPTTDLDVVAQARIL
DLLESIMQKQAPGMLLVTHDMGVVARLADDVAVMSDGKIVEQGDVETLFNAPKHTVTRSL
VSAHLALYGMELAS |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Navarro, C., Wu, L. F., Mandrand-Berthelot, M. A. (1993). "The nik operon of Escherichia coli encodes a periplasmic binding-protein-dependent transport system for nickel." Mol Microbiol 9:1181-1191. Pubmed: 7934931
- Sofia, H. J., Burland, V., Daniels, D. L., Plunkett, G. 3rd, Blattner, F. R. (1994). "Analysis of the Escherichia coli genome. V. DNA sequence of the region from 76.0 to 81.5 minutes." Nucleic Acids Res 22:2576-2586. Pubmed: 8041620
|
|---|