| Identification |
|---|
| Name: | Formate dehydrogenase, cytochrome b556(fdo) subunit |
|---|
| Synonyms: | - Aerobic formate dehydrogenase cytochrome b556 subunit
- FDH-Z subunit gamma
- Formate dehydrogenase-O subunit gamma
|
|---|
| Gene Name: | fdoI |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | Involved in respiratory electron transport chain |
|---|
| Specific Function: | Allows to use formate as major electron donor during aerobic respiration. Subunit gamma is probably the cytochrome b556(FDO) component of the formate dehydrogenase |
|---|
| Cellular Location: | Cell inner membrane; Multi-pass membrane protein |
|---|
| SMPDB Pathways: | - N-oxide electron transfer PW001889
- dimethyl sulfoxide electron transfer PW001892
|
|---|
| KEGG Pathways: | - Glyoxylate and dicarboxylate metabolism ec00630
|
|---|
| KEGG Reactions: | |
|---|
| SMPDB Reactions: | |
1.0 | + | 1.0menaquinone-8 | + | 1.0Electron | + | 1.0 | → | 1.0 | + | 1.0 | + | 1.0 |
| |
|
|---|
| Complex Reactions: | |
2.0 | + | 1.0Menaquinone 8 | + | 1.0 | → | 1.0 | + | 1.0 | + | 1.0 |
| | |
2.0 | + | 1.0 | + | 1.0 | → | 1.0 | + | 1.0 | + | 1.0 |
| |
|
|---|
| Metabolites: | |
|---|
| GO Classification: | | Component |
|---|
| cell part | | formate dehydrogenase complex | | integral to membrane | | intrinsic to membrane | | macromolecular complex | | membrane | | membrane part | | protein complex | | Function |
|---|
| catalytic activity | | electron carrier activity | | formate dehydrogenase activity | | oxidoreductase activity | | oxidoreductase activity, acting on the aldehyde or oxo group of donors | | oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor | | Process |
|---|
| cellular metabolic process | | cellular respiration | | electron transport chain | | energy derivation by oxidation of organic compounds | | generation of precursor metabolites and energy | | metabolic process | | respiratory electron transport chain |
|
|---|
| Gene Properties |
|---|
| Blattner: | b3892 |
|---|
| Gene Orientation | Counterclockwise |
|---|
| Centisome Percentage: | 87.92 |
|---|
| Left Sequence End | 4079248 |
|---|
| Right Sequence End | 4079883 |
|---|
| Gene Sequence: | >636 bp
ATGAATAAAGCAAAACGCCTGGAGATCCTCACTCGCCTGCGTGAGAACAATCCTCATCCC
ACCACCGAGCTTAATTTCAGTTCGCCTTTTGAATTGCTGATTGCCGTACTGCTTTCCGCT
CAGGCGACCGATGTCAGTGTTAATAAGGCGACGGCGAAACTCTACCCGGTGGCGAATACG
CCTGCAGCGATGCTTGAACTGGGCGTTGAAGGGGTGAAAACCTATATCAAAACGATTGGG
CTTTATAACAGCAAAGCAGAAAATATCATCAAAACCTGCCGTATCTTGCTGGAGCAGCAT
AATGGCGAGGTTCCGGAAGATCGTGCTGCGCTTGAAGCCCTGCCCGGCGTAGGTCGTAAA
ACAGCCAACGTCGTATTAAACACTGCATTCGGCTGGCCGACTATTGCTGTCGACACGCAC
ATTTTCCGCGTTTGTAATCGTACTCAATTTGCGCCGGGGAAAAACGTCGAACAGGTAGAA
GAAAAGCTACTGAAAGTGGTTCCAGCAGAGTTTAAAGTCGACTGCCACCATTGGTTGATC
CTGCACGGGCGTTATACCTGCATTGCCCGCAAGCCCCGCTGTGGCTCTTGTATTATTGAA
GATCTTTGTGAATACAAAGAGAAAGTTGACATCTGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 211 |
|---|
| Protein Molecular Weight: | 24606 |
|---|
| Protein Theoretical pI: | 11 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | - 18-32
- 54-72
- 113-130
- 152-170
|
|---|
| Protein Sequence: | >Formate dehydrogenase, cytochrome b556(fdo) subunit
MKRRDTIVRYTAPERINHWITAFCFILAAVSGLGFLFPSFNWLMQIMGTPQLARILHPFV
GVVMFASFIIMFFRYWHHNLINRDDIFWAKNIRKIVVNEEVGDTGRYNFGQKCVFWAAII
FLVLLLVSGVIIWRPYFAPAFSIPVIRFALMLHSFAAVALIVVIMVHIYAALWVKGTITA
MVEGWVTSAWAKKHHPRWYREVRKTTEKKAE |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Abaibou, H., Pommier, J., Benoit, S., Giordano, G., Mandrand-Berthelot, M. A. (1995). "Expression and characterization of the Escherichia coli fdo locus and a possible physiological role for aerobic formate dehydrogenase." J Bacteriol 177:7141-7149. Pubmed: 8522521
- Benoit, S., Abaibou, H., Mandrand-Berthelot, M. A. (1998). "Topological analysis of the aerobic membrane-bound formate dehydrogenase of Escherichia coli." J Bacteriol 180:6625-6634. Pubmed: 9852007
- Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Plunkett, G. 3rd, Burland, V., Daniels, D. L., Blattner, F. R. (1993). "Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes." Nucleic Acids Res 21:3391-3398. Pubmed: 8346018
|
|---|