| Identification |
|---|
| Name: | Heme exporter protein B |
|---|
| Synonyms: | - Cytochrome c-type biogenesis protein CcmB
|
|---|
| Gene Name: | ccmB |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | Involved in heme transporter activity |
|---|
| Specific Function: | Required for the export of heme to the periplasm for the biogenesis of c-type cytochromes |
|---|
| Cellular Location: | Cell inner membrane; Multi-pass membrane protein |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| EcoCyc Reactions: | |
1.0 | + | 1.0 | + | 1.0 | → | 1.0 | + | 1.0 | + | 1.0 | + | 1.0 |
| |
|
|---|
| Metabolites: | |
|---|
| GO Classification: | | Component |
|---|
| cell part | | membrane | | Function |
|---|
| cofactor transporter activity | | heme transporter activity | | transporter activity | | Process |
|---|
| cellular component assembly | | cellular component organization | | cellular component organization or biogenesis | | cellular protein complex assembly | | cofactor transport | | cytochrome complex assembly | | establishment of localization | | heme transport | | macromolecular complex assembly | | protein complex assembly | | transport |
|
|---|
| Gene Properties |
|---|
| Blattner: | b2200 |
|---|
| Gene Orientation | Counterclockwise |
|---|
| Centisome Percentage: | 49.45 |
|---|
| Left Sequence End | 2294384 |
|---|
| Right Sequence End | 2295046 |
|---|
| Gene Sequence: | >663 bp
ATGGAACTGTATCTGGATACTTCAGACGTTGTTGCGGTGAAGGCGCTGTCACGTATTTTT
CCGCTGGCGGGTGTGACCACTAACCCAAGCATTATCGCCGCGGGTAAAAAACCGCTGGAT
GTTGTGCTTCCGCAACTTCATGAAGCGATGGGCGGTCAGGGGCGTCTGTTTGCCCAGGTA
ATGGCTACCACTGCCGAAGGGATGGTTAATGACGCGCTTAAGCTGCGTTCTATTATTGCG
GATATCGTGGTGAAAGTTCCGGTGACCGCCGAGGGGCTGGCAGCTATTAAGATGTTAAAA
GCGGAAGGGATTCCGACGCTGGGAACCGCGGTATATGGCGCAGCACAAGGGCTGCTGTCG
GCGCTGGCAGGTGCGGAATATGTTGCGCCTTACGTTAATCGTATTGATGCTCAGGGCGGT
AGCGGCATTCAGACTGTGACCGACTTACACCAGTTATTGAAAATGCATGCGCCGCAGGCG
AAAGTGCTGGCAGCGAGTTTCAAAACCCCGCGTCAGGCGCTGGACTGCTTACTGGCAGGA
TGTGAATCAATTACTCTGCCACTGGATGTGGCACAACAGATGATTAGCTATCCGGCGGTT
GATGCCGCTGTGGCGAAGTTTGAGCAGGACTGGCAGGGAGCGTTTGGCAGAACGTCGATT
TAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 220 |
|---|
| Protein Molecular Weight: | 23618 |
|---|
| Protein Theoretical pI: | 8 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | - 21-41
- 45-65
- 101-121
- 128-148
- 159-179
- 193-213
|
|---|
| Protein Sequence: | >Heme exporter protein B
MMFWRIFRLELRVAFRHSAEIANPLWFFLIVITLFPLSIGPEPQLLARIAPGIIWVAALL
SSLLALERLFRDDLQDGSLEQLMLLPLPLPAVVLAKVMAHWMVTGLPLLILSPLVAMLLG
MDVYGWQVMALTLLLGTPTLGFLGAPGVALTVGLKRGGVLLSILVLPLTIPLLIFATAAM
DAASMHLPVDGYLAILGALLAGTATLSPFATAAALRISIQ |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Thony-Meyer, L., Fischer, F., Kunzler, P., Ritz, D., Hennecke, H. (1995). "Escherichia coli genes required for cytochrome c maturation." J Bacteriol 177:4321-4326. Pubmed: 7635817
|
|---|