Identification |
---|
Name: | Protein-L-isoaspartate O-methyltransferase |
---|
Synonyms: | - L-isoaspartyl protein carboxyl methyltransferase
- Protein L-isoaspartyl methyltransferase
- Protein-beta-aspartate methyltransferase
- PIMT
|
---|
Gene Name: | pcm |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | Involved in protein-L-isoaspartate (D-aspartate) O-methyltransferase activity |
---|
Specific Function: | Catalyzes the methyl esterification of L-isoaspartyl residues in peptides and proteins that result from spontaneous decomposition of normal L-aspartyl and L-asparaginyl residues. It plays a role in the repair and/or degradation of damaged proteins. This enzyme does not act on D-aspartyl residues |
---|
Cellular Location: | Cytoplasm |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
KEGG Reactions: | |
1.0 | + | 1.0Protein L-isoaspartate | ↔ | 1.0 | + | 1.0Protein L-isoaspartate methyl ester |
| |
|
---|
EcoCyc Reactions: | |
1.0 | + | 1.0a [protein]-L-β-isoaspartate | → | 1.0 | + | 1.0a protein L-β-isoaspartate α-methyl ester | + | 1.0 |
| |
|
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
catalytic activity | methyltransferase activity | protein-L-isoaspartate (D-aspartate) O-methyltransferase activity | S-adenosylmethionine-dependent methyltransferase activity | transferase activity | transferase activity, transferring one-carbon groups | Process |
---|
macromolecule metabolic process | macromolecule modification | metabolic process | protein modification process |
|
---|
Gene Properties |
---|
Blattner: | b2743 |
---|
Gene Orientation | Counterclockwise |
---|
Centisome Percentage: | 61.79 |
---|
Left Sequence End | 2866915 |
---|
Right Sequence End | 2867541 |
---|
Gene Sequence: | >627 bp
ATGACATACGATAGTGAATTCGGATCACATGTATCCCTATATCGGGATAGAATCAAACAG
GTTATTGATGACTCCCTAAACGAACATCTTAACTCAATGATTCTACGTGTTGATCTGCAT
GACCCAATTGATACAGAAAATATGGATAACCCATTCTTTCAACCCAGGGTTGACTCTGGT
GCTATATCTCGCTTTACCAGTGCGTTAAAAGCAAAGCTTAAACATGATAAGCATATTAAA
ACTCAACGGAAAGACTGGCCTGATAGTCGACATTCCACTTTACGTTACGCATGGGTCAGA
GAATATACCAAAAATAGAAAGCGGCATTACCATTTGATACTGTGTTTCAATCAGGATGCT
TATTATCATTTAGGTGATTACGACTTAAACCGTAACACGTTACGTACAATGATAACGACA
GCTTGGTACAGTGCACTTGGCATCCCTATAGATAGCTCGGGGAAGTTAGTTAATTACCCG
CCAAATGGCAAATACCTTCTCAATCGTAAAAGGGACAACTTTGAGCAGACTTATAGCGAT
TTGATGAATAGGGTGGATTACATGACCAAAGTAAGGACTAAAATAGTCGGTGACGGAGAC
CGTAATTTCGGCTGCAGTCGCGGGTAA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 208 |
---|
Protein Molecular Weight: | 23258 |
---|
Protein Theoretical pI: | 7 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Protein-L-isoaspartate O-methyltransferase
MVSRRVQALLDQLRAQGIQDEQVLNALAAVPREKFVDEAFEQKAWDNIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVQHVCSVERIKGLQWQARRRLKNL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMTQLDEGGILVLPVGEEHQYLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Fu, J. C., Ding, L., Clarke, S. (1991). "Purification, gene cloning, and sequence analysis of an L-isoaspartyl protein carboxyl methyltransferase from Escherichia coli." J Biol Chem 266:14562-14572. Pubmed: 1860862
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Ichikawa, J. K., Li, C., Fu, J., Clarke, S. (1994). "A gene at 59 minutes on the Escherichia coli chromosome encodes a lipoprotein with unusual amino acid repeat sequences." J Bacteriol 176:1630-1638. Pubmed: 8132457
- Li, C., Ichikawa, J. K., Ravetto, J. J., Kuo, H. C., Fu, J. C., Clarke, S. (1994). "A new gene involved in stationary-phase survival located at 59 minutes on the Escherichia coli chromosome." J Bacteriol 176:6015-6022. Pubmed: 7928962
- Takayanagi, Y., Tanaka, K., Takahashi, H. (1994). "Structure of the 5' upstream region and the regulation of the rpoS gene of Escherichia coli." Mol Gen Genet 243:525-531. Pubmed: 8208244
|
---|