Identification |
---|
Name: | Taurine import ATP-binding protein TauB |
---|
Synonyms: | Not Available |
---|
Gene Name: | tauB |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | Involved in nucleotide binding |
---|
Specific Function: | Part of the ABC transporter complex TauABC involved in taurine import. Responsible for energy coupling to the transport system |
---|
Cellular Location: | Cell inner membrane; Peripheral membrane protein |
---|
SMPDB Pathways: | |
---|
KEGG Pathways: | |
---|
Transports: | |
---|
Transport References: | Not Available |
---|
SMPDB Reactions: | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00251/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00538/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | → | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00251/thumb.png) | + | 1.0Adenosine diphosphate | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01429/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01341/thumb.png) |
| |
|
---|
EcoCyc Reactions: | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00538/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00251/thumb.png) | → | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01341/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01429/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00251/thumb.png) |
| |
|
---|
Complex Reactions: | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00538/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21233/thumb.png) | → | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01341/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21233/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01429/thumb.png) |
| | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00538/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21313/thumb.png) | → | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01341/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21313/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21225/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01429/thumb.png) |
| | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00538/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00251/thumb.png) | → | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB01341/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB21380/thumb.png) | + | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00251/thumb.png) |
| |
|
---|
Metabolites: | |
---|
GO Classification: | Component |
---|
cell part | membrane | Function |
---|
active transmembrane transporter activity | adenyl nucleotide binding | adenyl ribonucleotide binding | amine transmembrane transporter activity | ATP binding | ATPase activity | binding | catalytic activity | hydrolase activity | hydrolase activity, acting on acid anhydrides | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | nucleoside binding | nucleoside-triphosphatase activity | nucleotide binding | purine nucleoside binding | pyrophosphatase activity | taurine transmembrane transporter activity | taurine-transporting ATPase activity | transmembrane transporter activity | transporter activity | Process |
---|
carboxylic acid transport | establishment of localization | monocarboxylic acid transport | organic acid transport | taurine transport | transport |
|
---|
Gene Properties |
---|
Blattner: | b0366 |
---|
Gene Orientation | Clockwise |
---|
Centisome Percentage: | 8.31 |
---|
Left Sequence End | 385431 |
---|
Right Sequence End | 386198 |
---|
Gene Sequence: | >768 bp
ATGTGCGAATTGCTCGGGATGAGCGCCAACGTCCCTACCGATATCTGCTTTAGTTTCACC
GGGCTTGTACAGCGTGGTGGTGGAACCGGGCCACATAAAGATGGCTGGGGCATTACCTTT
TACGAAGGTAAAGGCTGTCGCACATTTAAAGATCCACAACCCAGCTTTAATTCCCCCATC
GCCAAACTTGTCCAGGACTACCCGATAAAATCCTGTTCGGTGGTGGCTCATATTCGCCAG
GCTAATCGGGGCGAGGTGGCGCTGGAAAATACTCACCCATTTACCCGCGAGTTATGGGGG
CGTAACTGGACTTATGCCCATAACGGACAACTGACGGGCTACAAATCACTGGAAACCGGC
AACTTCCGCCCGGTAGGCGAAACCGACAGCGAAAAAGCCTTCTGCTGGCTCCTGCATAAA
TTAACGCAGCGTTACCCGCGCACACCGGGCAACATGGCGGCGGTATTTAAATATATCGCC
TCACTGGCGGATGAACTGCGGCAGAAGGGCGTTTTCAACATGCTGCTTTCGGACGGGCGC
TATGTAATGGCGTATTGCTCGACTAATTTACACTGGATCACCCGCCGCGCGCCGTTTGGC
GTGGCAACGTTGCTGGATCAGGATGTGGAAATCGACTTCAGCTCGCAGACCACACCGAAT
GATGTGGTCACGGTGATTGCAACACAGCCGCTGACGGGCAATGAAACCTGGCAAAAGATT
ATGCCAGGCGAATGGCGCTTATTTTGCCTCGGGGAGCGTGTAGTTTGA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 255 |
---|
Protein Molecular Weight: | 28297 |
---|
Protein Theoretical pI: | 7 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Taurine import ATP-binding protein TauB
MLQISHLYADYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLNLIAGFVPYQHGSIQL
AGKRIEGPGAERGVVFQNEGLLPWRNVQDNVAFGLQLAGIEKMQRLEIAHQMLKKVGLEG
AEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFTRDQMQTLLLKLWQETGK
QVLLITHDIEEAVFMATELVLLSSGPGRVLERLPLNFARRFVAGESSRSIKSDPQFIAMR
EYVLSRVFEQREAFS |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Eichhorn, E., van der Ploeg, J. R., Leisinger, T. (2000). "Deletion analysis of the Escherichia coli taurine and alkanesulfonate transport systems." J Bacteriol 182:2687-2695. Pubmed: 10781534
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- van der Ploeg, J. R., Weiss, M. A., Saller, E., Nashimoto, H., Saito, N., Kertesz, M. A., Leisinger, T. (1996). "Identification of sulfate starvation-regulated genes in Escherichia coli: a gene cluster involved in the utilization of taurine as a sulfur source." J Bacteriol 178:5438-5446. Pubmed: 8808933
|
---|