| Identification |
|---|
| Name: | Ureidoglycolate hydrolase |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | allA |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | Involved in ureidoglycolate hydrolase activity |
|---|
| Specific Function: | Involved in the anaerobic utilization of allantoin. Reinforces the induction of genes involved in the degradation of allantoin and glyoxylate by producing glyoxylate |
|---|
| Cellular Location: | Cytoplasmic |
|---|
| SMPDB Pathways: | - glycolate and glyoxylate degradation PW000827
|
|---|
| KEGG Pathways: | |
|---|
| KEGG Reactions: | |
|---|
| EcoCyc Reactions: | |
|---|
| Complex Reactions: | |
2.0 | + | 1.0 | + | 1.0 | → | 1.0 | + | 1.0 | + | 2.0 |
| | | |
|
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| catalytic activity | | hydrolase activity | | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds | | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines | | ureidoglycolate hydrolase activity | | Process |
|---|
| allantoin catabolic process | | allantoin metabolic process | | amine metabolic process | | metabolic process | | nitrogen compound metabolic process |
|
|---|
| Gene Properties |
|---|
| Blattner: | b0505 |
|---|
| Gene Orientation | Clockwise |
|---|
| Centisome Percentage: | 11.46 |
|---|
| Left Sequence End | 531675 |
|---|
| Right Sequence End | 532157 |
|---|
| Gene Sequence: | >483 bp
ATGAAACTTCAGGTATTACCGTTAAGTCAGGAAGCCTTTAGTGCTTATGGCGACGTAATC
GAAACGCAGCAACGGGATTTTTTCCATATTAACAATGGCCTGGTGGAGCGTTACCACGAT
TTGGCGCTGGTTGAGATTCTTGAGCAAGACTGTACGCTTATCAGCATTAACCGCGCGCAA
CCGGCGAATCTGCCGCTGACCATTCACGAACTCGAACGTCATCCGCTGGGTACTCAGGCC
TTTATCCCGATGAAAGGTGAGGTGTTTGTGGTGGTCGTGGCGTTAGGTGACGACAAACCA
GACCTGTCAACGCTGCGGGCGTTTATCACCAACGGCGAACAGGGAGTGAATTACCATCGT
AACGTCTGGCATCACCCACTTTTCGCCTGGCAGCGCGTCACCGATTTTCTGACCATCGAT
CGCGGCGGCAGTGACAACTGTGATGTTGAAAGTATTCCTGAACAGGAACTCTGTTTTGCG
TGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 160 |
|---|
| Protein Molecular Weight: | 18169 |
|---|
| Protein Theoretical pI: | 5 |
|---|
| PDB File: | 1XSQ |
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Ureidoglycolate hydrolase
MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVEILEQDCTLISINRAQ
PANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHR
NVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Cusa, E., Obradors, N., Baldoma, L., Badia, J., Aguilar, J. (1999). "Genetic analysis of a chromosomal region containing genes required for assimilation of allantoin nitrogen and linked glyoxylate metabolism in Escherichia coli." J Bacteriol 181:7479-7484. Pubmed: 10601204
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
|
|---|