Identification |
---|
Name: | Ureidoglycolate hydrolase |
---|
Synonyms: | Not Available |
---|
Gene Name: | allA |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | Involved in ureidoglycolate hydrolase activity |
---|
Specific Function: | Involved in the anaerobic utilization of allantoin. Reinforces the induction of genes involved in the degradation of allantoin and glyoxylate by producing glyoxylate |
---|
Cellular Location: | Cytoplasmic |
---|
SMPDB Pathways: | - glycolate and glyoxylate degradation PW000827
|
---|
KEGG Pathways: | |
---|
KEGG Reactions: | |
---|
EcoCyc Reactions: | |
---|
Complex Reactions: | |
2.0 | + | 1.0 | + | 1.0 | → | 1.0 | + | 1.0 | + | 2.0 |
| | | |
|
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
catalytic activity | hydrolase activity | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines | ureidoglycolate hydrolase activity | Process |
---|
allantoin catabolic process | allantoin metabolic process | amine metabolic process | metabolic process | nitrogen compound metabolic process |
|
---|
Gene Properties |
---|
Blattner: | b0505 |
---|
Gene Orientation | Clockwise |
---|
Centisome Percentage: | 11.46 |
---|
Left Sequence End | 531675 |
---|
Right Sequence End | 532157 |
---|
Gene Sequence: | >483 bp
ATGAAACTTCAGGTATTACCGTTAAGTCAGGAAGCCTTTAGTGCTTATGGCGACGTAATC
GAAACGCAGCAACGGGATTTTTTCCATATTAACAATGGCCTGGTGGAGCGTTACCACGAT
TTGGCGCTGGTTGAGATTCTTGAGCAAGACTGTACGCTTATCAGCATTAACCGCGCGCAA
CCGGCGAATCTGCCGCTGACCATTCACGAACTCGAACGTCATCCGCTGGGTACTCAGGCC
TTTATCCCGATGAAAGGTGAGGTGTTTGTGGTGGTCGTGGCGTTAGGTGACGACAAACCA
GACCTGTCAACGCTGCGGGCGTTTATCACCAACGGCGAACAGGGAGTGAATTACCATCGT
AACGTCTGGCATCACCCACTTTTCGCCTGGCAGCGCGTCACCGATTTTCTGACCATCGAT
CGCGGCGGCAGTGACAACTGTGATGTTGAAAGTATTCCTGAACAGGAACTCTGTTTTGCG
TGA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 160 |
---|
Protein Molecular Weight: | 18169 |
---|
Protein Theoretical pI: | 5 |
---|
PDB File: | 1XSQ |
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Ureidoglycolate hydrolase
MKLQVLPLSQEAFSAYGDVIETQQRDFFHINNGLVERYHDLALVEILEQDCTLISINRAQ
PANLPLTIHELERHPLGTQAFIPMKGEVFVVVVALGDDKPDLSTLRAFITNGEQGVNYHR
NVWHHPLFAWQRVTDFLTIDRGGSDNCDVESIPEQELCFA |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Cusa, E., Obradors, N., Baldoma, L., Badia, J., Aguilar, J. (1999). "Genetic analysis of a chromosomal region containing genes required for assimilation of allantoin nitrogen and linked glyoxylate metabolism in Escherichia coli." J Bacteriol 181:7479-7484. Pubmed: 10601204
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
|
---|