Cation efflux system protein cusF (P77214)

Identification
Name:Cation efflux system protein cusF
Synonyms:Not Available
Gene Name:cusF
Enzyme Class:Not Available
Biological Properties
General Function:Involved in copper ion binding
Specific Function:Part of a cation efflux system that mediates resistance to copper and silver. Binds one copper per polypeptide
Cellular Location:Periplasm
SMPDB Pathways:Not Available
KEGG Pathways:
Transports:
Transport References:
  • Orth, J. D., Conrad, T. M., Na, J., Lerman, J. A., Nam, H., Feist, A. M., Palsson, B. O. (2011). "A comprehensive genome-scale reconstruction of Escherichia coli metabolism--2011." Mol Syst Biol 7:535. Pubmed: 21988831
Metabolites:
ECMDB IDNameView
ECMDB00657CopperMetaboCard
ECMDB21225Hydrogen ionMetaboCard
GO Classification:Not Available
Gene Properties
Blattner:b0573
Gene OrientationClockwise
Centisome Percentage:12.85
Left Sequence End596354
Right Sequence End596686
Gene Sequence:
>333 bp
ATGAGCTTTTTTATTTCTGATGCGGTAGCGGCAACGGGTGCACCGGCGCAAGGTAGCCCG
ATGTCTTTGATTTTGATGCTGGTGGTATTCGGTCTGATTTTCTATTTCATGATCCTGCGT
CCACAGCAGAAGCGCACCAAAGAACACAAAAAGCTGATGGACTCCATTGCCAAAGGTGAT
GAAGTTCTGACGAACGGTGGCCTGGTTGGTCGCGTAACCAAAGTAGCGGAAAACGGCTAC
ATTGCTATCGCGCTGAATGACACCACTGAAGTAGTTATTAAACGTGACTTCGTAGCTGCC
GTCCTGCCGAAAGGCACCATGAAGGCGCTGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:110
Protein Molecular Weight:12251
Protein Theoretical pI:8
Signaling Regions:
  • 1-21
Transmembrane Regions:
  • None
Protein Sequence:
>Cation efflux system protein cusF
MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVKGIDLESKKITIHHDP
IAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
References
External Links:
ResourceLink
Uniprot ID:P77214
Uniprot Name:CUSF_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674547
Ecogene ID:EG14234
Ecocyc:EG14234
ColiBase:b0573
Kegg Gene:b0573
EchoBASE ID:EB3985
CCDB:CUSF_ECOLI
BacMap:16128556
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Franke, S., Grass, G., Nies, D. H. (2001). "The product of the ybdE gene of the Escherichia coli chromosome is involved in detoxification of silver ions." Microbiology 147:965-972. Pubmed: 11283292
  • Franke, S., Grass, G., Rensing, C., Nies, D. H. (2003). "Molecular analysis of the copper-transporting efflux system CusCFBA of Escherichia coli." J Bacteriol 185:3804-3812. Pubmed: 12813074
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Oshima, T., Aiba, H., Baba, T., Fujita, K., Hayashi, K., Honjo, A., Ikemoto, K., Inada, T., Itoh, T., Kajihara, M., Kanai, K., Kashimoto, K., Kimura, S., Kitagawa, M., Makino, K., Masuda, S., Miki, T., Mizobuchi, K., Mori, H., Motomura, K., Nakamura, Y., Nashimoto, H., Nishio, Y., Saito, N., Horiuchi, T., et, a. l. .. (1996). "A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map." DNA Res 3:137-155. Pubmed: 8905232
  • Outten, F. W., Huffman, D. L., Hale, J. A., O'Halloran, T. V. (2001). "The independent cue and cus systems confer copper tolerance during aerobic and anaerobic growth in Escherichia coli." J Biol Chem 276:30670-30677. Pubmed: 11399769