Identification |
---|
Name: | Ascorbate-specific phosphotransferase enzyme IIA component |
---|
Synonyms: | - PTS system ascorbate-specific EIIA component
|
---|
Gene Name: | ulaC |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | Involved in transporter activity |
---|
Specific Function: | The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane. This system is involved in ascorbate transport |
---|
Cellular Location: | Cytoplasm (Probable) |
---|
SMPDB Pathways: | |
---|
KEGG Pathways: | - Amino sugar and nucleotide sugar metabolism ec00520
- Ascorbate and aldarate metabolism ec00053
- Fructose and mannose metabolism ec00051
- Galactose metabolism ec00052
- Glycolysis / Gluconeogenesis ec00010
- Metabolic pathways eco01100
- Microbial metabolism in diverse environments ec01120
- Pentose phosphate pathway ec00030
- Starch and sucrose metabolism ec00500
|
---|
KEGG Reactions: | |
1.0Protein N(pi)-phospho-L-histidine | + | 1.0 | ↔ | 1.0Protein histidine | + | 1.0 |
| | |
1.0Protein N(pi)-phospho-L-histidine | + | 1.0Sugar | ↔ | 1.0Protein histidine | + | 1.0 |
| |
|
---|
SMPDB Reactions: | |
1.0Ascorbic acid | + | 1.0HPr - phosphorylated | + | 1.0 | → | 1.0L-ascorbate 6-phosphate | + | 1.0HPr | + | 1.0 |
| |
|
---|
EcoCyc Reactions: | |
---|
Complex Reactions: | |
1.0Protein EIIA N(pi)-phospho-L-histidine | + | 1.0protein EIIB | → | 1.0protein EIIA | + | 1.0protein EIIB N(pi)-phospho-L-histidine/cysteine |
| 1.0Protein EIIA N(pi)-phospho-L-histidine + 1.0protein EIIB → 1.0protein EIIA + 1.0protein EIIB N(pi)-phospho-L-histidine/cysteine ReactionCard |
|
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cation transmembrane transporter activity | cation:sugar symporter activity | ion transmembrane transporter activity | solute:cation symporter activity | substrate-specific transmembrane transporter activity | sugar:hydrogen symporter activity | transmembrane transporter activity | transporter activity | Process |
---|
carbohydrate transport | establishment of localization | phosphoenolpyruvate-dependent sugar phosphotransferase system | transport |
|
---|
Gene Properties |
---|
Blattner: | b4195 |
---|
Gene Orientation | Clockwise |
---|
Centisome Percentage: | 95.26 |
---|
Left Sequence End | 4419731 |
---|
Right Sequence End | 4420195 |
---|
Gene Sequence: | >465 bp
ATGACTGATTACGCGATAAGCAAGAAAAGCAAGCGATCGCTTTGGATCCCGATTCTGGTA
TTCATTACCCTCGCGGCCTGTGCCAGCGCAGGTTACAGCTACTGGCATTCGCATCAGGTT
GCCGCTGACGACAAAGCGCAGCAACGCGTCGTGCCCTCACCGGTCTTCTACGCGCTGGAT
ACCTTCACGGTCAATTTGGGCGATGCGGATCGCGTACTTTATATCGGCATAACCCTGCGC
CTGAAAGATGAAGCTACCCGCTCGCGGCTGAGTGAGTATTTGCCGGAAGTCCGTAGTCGC
TTGCTGTTACTGTTTTCGCGTCAGGATGCTGCCGTACTGGCGACAGAAGAAGGCAAGAAA
AACCTGATTGCCGAGATTAAAACCACACTTTCCACCCCGCTTGTTGCCGGGCAACCGAAA
CAGGATGTCACCGACGTGCTGTATACCGCTTTTATTCTGCGATAA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 154 |
---|
Protein Molecular Weight: | 17237 |
---|
Protein Theoretical pI: | 4 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Ascorbate-specific phosphotransferase enzyme IIA component
MKLRDSLAENKSIRLQAEAETWQEAVKIGVDLLVAADVVEPRYYQAILDGVEQFGPYFVI
APGLAMPHGRPEEGVKKTGFSLVTLKKPLEFNHDDNDPVDILITMAAVDANTHQEVGIMQ
IVNLFEDEENFDRLRACRTEQEVLDLIDRTNAAA |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L., Blattner, F. R. (1995). "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes." Nucleic Acids Res 23:2105-2119. Pubmed: 7610040
- Campos, E., Aguilar, J., Baldoma, L., Badia, J. (2002). "The gene yjfQ encodes the repressor of the yjfR-X regulon (ula), which is involved in L-ascorbate metabolism in Escherichia coli." J Bacteriol 184:6065-6068. Pubmed: 12374842
- Campos, E., Baldoma, L., Aguilar, J., Badia, J. (2004). "Regulation of expression of the divergent ulaG and ulaABCDEF operons involved in LaAscorbate dissimilation in Escherichia coli." J Bacteriol 186:1720-1728. Pubmed: 14996803
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Zhang, Z., Aboulwafa, M., Smith, M. H., Saier, M. H. Jr (2003). "The ascorbate transporter of Escherichia coli." J Bacteriol 185:2243-2250. Pubmed: 12644495
|
---|