Identification |
---|
Name: | 6-carboxy-5,6,7,8-tetrahydropterin synthase |
---|
Synonyms: | - CPH4 synthase
- Queuosine biosynthesis protein queD
|
---|
Gene Name: | queD |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | Coenzyme transport and metabolism |
---|
Specific Function: | Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde. Can also convert 6-pyruvoyltetrahydropterin (PPH4) and sepiapterin to CPH4; these 2 compounds are probably intermediates in the reaction from H2NTP |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | |
---|
KEGG Pathways: | |
---|
KEGG Reactions: | |
---|
SMPDB Reactions: | |
1.0 | + | 1.0 | → | 1.0 | + | 1.0Triphosphate | + | 2.0 | + | 1.0 | + | 1.0 |
| |
|
---|
EcoCyc Reactions: | |
1.0 | + | 1.0 | → | 1.0 | + | 1.0 | + | 1.0 | + | 1.0 |
| |
|
---|
Complex Reactions: | |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
6-pyruvoyltetrahydropterin synthase activity | binding | carbon-oxygen lyase activity | carbon-oxygen lyase activity, acting on phosphates | catalytic activity | cation binding | ion binding | lyase activity | metal ion binding | Process |
---|
biosynthetic process | cellular biosynthetic process | heterocycle biosynthetic process | metabolic process | pteridine and derivative biosynthetic process | tetrahydrobiopterin biosynthetic process |
|
---|
Gene Properties |
---|
Blattner: | b2765 |
---|
Gene Orientation | Clockwise |
---|
Centisome Percentage: | 62.29 |
---|
Left Sequence End | 2890236 |
---|
Right Sequence End | 2890601 |
---|
Gene Sequence: | >366 bp
ATGATCAGCAGAGTGACAGAAGCTCTAAGCAAAGTTAAAGGATCGATGGGAAGCCACGAG
CGCCATGCATTGCCTGGTGTTATCGGTGACGATCTTTTGCGATTTGGGAAGCTGCCACTC
TGCCTGTTCATTTGCATTATTTTGACGGCGGTGACTGTGGTAACCACGGCGCACCATACC
CGTTTACTGACCGCTCAGCGCGAACAACTGGTGCTGGAGCGAGATGCTTTAGACATTGAA
TGGCGCAACCTGATCCTTGAAGAGAATGCGCTCGGCGACCATAGCCGGGTGGAAAGGATC
GCCACGGAAAAGCTGCAAATGCAGCATGTTGATCCGTCACAAGAAAATATCGTAGTGCAA
AAATAA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 121 |
---|
Protein Molecular Weight: | 13773 |
---|
Protein Theoretical pI: | 7 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >6-carboxy-5,6,7,8-tetrahydropterin synthase
MMSTTLFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKA
AFKPTYERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRG
E |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- McCarty, R. M., Somogyi, A., Bandarian, V. (2009). "Escherichia coli QueD is a 6-carboxy-5,6,7,8-tetrahydropterin synthase." Biochemistry 48:2301-2303. Pubmed: 19231875
|
---|