| Identification |
|---|
| Name: | Cytochrome bd-I ubiquinol oxidase subunit X |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | cydX |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | oxidative phosphorylation |
|---|
| Specific Function: | Required for correct functioning of cytochrome bd-I oxidase. This protein and AppX may have some functional overlap. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | - Oxidative phosphorylation PW000919
- pyruvate to cytochrome bd terminal oxidase electron transfer PW002087
|
|---|
| KEGG Pathways: | |
|---|
| SMPDB Reactions: | |
2.0 | + | 1.0 | + | 4.0 | → | 2.0 | + | 2.0 | + | 4.0 |
| | |
1.0 | + | 4.0 | + | 1.0Electron | → | 2.0 |
| |
|
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| integral component of plasma membrane | | membrane | | outer membrane | | oxidative phosphorylation | | oxidoreductase activity, acting on diphenols and related substances as donors | | plasma membrane |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >114
atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc
gcgctggcgcttgaacacgtcgaatcaggcaaagccggtcaagaagacatctga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 37 |
|---|
| Protein Molecular Weight: | 4041 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Cytochrome bd-I ubiquinol oxidase subunit X
MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|