Identification |
---|
Name: | Cytochrome bd-I ubiquinol oxidase subunit X |
---|
Synonyms: | Not Available |
---|
Gene Name: | cydX |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | oxidative phosphorylation |
---|
Specific Function: | Required for correct functioning of cytochrome bd-I oxidase. This protein and AppX may have some functional overlap. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | - Oxidative phosphorylation PW000919
- pyruvate to cytochrome bd terminal oxidase electron transfer PW002087
|
---|
KEGG Pathways: | |
---|
SMPDB Reactions: | |
2.0 | + | 1.0 | + | 4.0 | → | 2.0 | + | 2.0 | + | 4.0 |
| | |
1.0 | + | 4.0 | + | 1.0Electron | → | 2.0 |
| |
|
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
integral component of plasma membrane | membrane | outer membrane | oxidative phosphorylation | oxidoreductase activity, acting on diphenols and related substances as donors | plasma membrane |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >114
atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc
gcgctggcgcttgaacacgtcgaatcaggcaaagccggtcaagaagacatctga |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 37 |
---|
Protein Molecular Weight: | 4041 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Cytochrome bd-I ubiquinol oxidase subunit X
MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|