
Cytochrome bd-I ubiquinol oxidase subunit X (P56100)
Identification | |||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Name: | Cytochrome bd-I ubiquinol oxidase subunit X | ||||||||||||||||||
Synonyms: | Not Available | ||||||||||||||||||
Gene Name: | cydX | ||||||||||||||||||
Enzyme Class: | |||||||||||||||||||
Biological Properties | |||||||||||||||||||
General Function: | oxidative phosphorylation | ||||||||||||||||||
Specific Function: | Required for correct functioning of cytochrome bd-I oxidase. This protein and AppX may have some functional overlap. | ||||||||||||||||||
Cellular Location: | Not Available | ||||||||||||||||||
SMPDB Pathways: | |||||||||||||||||||
KEGG Pathways: |
| ||||||||||||||||||
SMPDB Reactions: |
| ||||||||||||||||||
Metabolites: |
| ||||||||||||||||||
GO Classification: |
| ||||||||||||||||||
Gene Properties | |||||||||||||||||||
Blattner: | Not Available | ||||||||||||||||||
Gene Orientation | Not Available | ||||||||||||||||||
Centisome Percentage: | Not Available | ||||||||||||||||||
Left Sequence End | Not Available | ||||||||||||||||||
Right Sequence End | Not Available | ||||||||||||||||||
Gene Sequence: | >114 atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc gcgctggcgcttgaacacgtcgaatcaggcaaagccggtcaagaagacatctga | ||||||||||||||||||
Protein Properties | |||||||||||||||||||
Pfam Domain Function: | Not Available | ||||||||||||||||||
Protein Residues: | 37 | ||||||||||||||||||
Protein Molecular Weight: | 4041 | ||||||||||||||||||
Protein Theoretical pI: | Not Available | ||||||||||||||||||
Signaling Regions: | Not Available | ||||||||||||||||||
Transmembrane Regions: |
| ||||||||||||||||||
Protein Sequence: | >Cytochrome bd-I ubiquinol oxidase subunit X MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI | ||||||||||||||||||
References | |||||||||||||||||||
External Links: |
| ||||||||||||||||||
General Reference: | Not Available |