
Threonylcarbamoyl-AMP synthase (P45748)
Identification | |||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Name: | Threonylcarbamoyl-AMP synthase | ||||||||||||||||||||||||
Synonyms: | Not Available | ||||||||||||||||||||||||
Gene Name: | tsaC | ||||||||||||||||||||||||
Enzyme Class: | |||||||||||||||||||||||||
Biological Properties | |||||||||||||||||||||||||
General Function: | threonylcarbamoyladenosine biosynthetic process | ||||||||||||||||||||||||
Specific Function: | Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Catalyzes the conversion of L-threonine, bicarbonate/CO(2) and ATP to give threonylcarbamoyl-AMP (TC-AMP) as the acyladenylate intermediate, with the release of pyrophosphate. Is also able to catalyze the reverse reaction in vitro, i.e. the formation of ATP from TC-AMP and PPi. Shows higher affinity for the full-length tRNA(Thr) lacking only the t(6)A37 modification than for its fully modified counterpart. Could also be required for the maturation of 16S rRNA. Binds to double-stranded RNA but does not interact tightly with either of the ribosomal subunits, or the 70S particles. | ||||||||||||||||||||||||
Cellular Location: | Not Available | ||||||||||||||||||||||||
SMPDB Pathways: | Not Available | ||||||||||||||||||||||||
KEGG Pathways: | Not Available | ||||||||||||||||||||||||
KEGG Reactions: |
| ||||||||||||||||||||||||
Metabolites: |
| ||||||||||||||||||||||||
GO Classification: |
| ||||||||||||||||||||||||
Gene Properties | |||||||||||||||||||||||||
Blattner: | Not Available | ||||||||||||||||||||||||
Gene Orientation | Not Available | ||||||||||||||||||||||||
Centisome Percentage: | Not Available | ||||||||||||||||||||||||
Left Sequence End | Not Available | ||||||||||||||||||||||||
Right Sequence End | Not Available | ||||||||||||||||||||||||
Gene Sequence: | >573 gtgaataataacctgcaaagagacgctatcgcagctgcgatagatgttctcaatgaagaa cgtgtcatcgcctatccaacggaagccgttttcggtgttgggtgcgatcctgatagcgaa acagcagtgatgcgactgttggagttaaaacagcgtccggttgataaggggctgatttta atcgcagcaaattacgagcagcttaaaccctatattgatgacaccatgttgactgacgtg cagcgtgaaaccattttttcccgctggccaggtcctgtcacctttgtctttcccgcgcct gcgacaacaccgcgctggttgacgggccgctttgattcgcttgctgtacgagtcaccgac catccgttggtggttgctttgtgccaggcttatggtaaaccgctggtttctaccagtgcc aacttgagtggattgccaccttgtcgaacagtagacgaagttcgcgcacaatttggcgcg gcgttcccggttgtgcctggtgaaacgggggggcgtttaaatccttcagaaatccgcgat gccctgacgggtgaactgtttcgacaggggtaa | ||||||||||||||||||||||||
Protein Properties | |||||||||||||||||||||||||
Pfam Domain Function: | Not Available | ||||||||||||||||||||||||
Protein Residues: | 190 | ||||||||||||||||||||||||
Protein Molecular Weight: | 20767 | ||||||||||||||||||||||||
Protein Theoretical pI: | Not Available | ||||||||||||||||||||||||
PDB File: | 1HRU | ||||||||||||||||||||||||
Signaling Regions: | Not Available | ||||||||||||||||||||||||
Transmembrane Regions: | Not Available | ||||||||||||||||||||||||
Protein Sequence: | >Threonylcarbamoyl-AMP synthase MNNNLQRDAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVMRLLELKQRPVDKGLIL IAANYEQLKPYIDDTMLTDVQRETIFSRWPGPVTFVFPAPATTPRWLTGRFDSLAVRVTD HPLVVALCQAYGKPLVSTSANLSGLPPCRTVDEVRAQFGAAFPVVPGETGGRLNPSEIRD ALTGELFRQG | ||||||||||||||||||||||||
References | |||||||||||||||||||||||||
External Links: |
| ||||||||||||||||||||||||
General Reference: | Not Available |