Identification |
---|
Name: | DNA adenine methylase |
---|
Synonyms: | - DNA adenine methyltransferase
- Deoxyadenosyl-methyltransferase
- M.EcoDam
|
---|
Gene Name: | dam |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | Involved in site-specific DNA-methyltransferase (adenine-specific) activity |
---|
Specific Function: | Methylates DNA within the sequence GATC and protects the DNA from cleavage by the restriction endonuclease MboI. Although it shares sequence specificity with a number of type II restriction endonucleases and methylases, it is thought to act in postreplication mismatch repair rather than as a part of a restriction modification system. May also play a role in DNA replication |
---|
Cellular Location: | Cytoplasmic |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | |
---|
KEGG Reactions: | |
1.0 | + | 1.0DNA adenine | ↔ | 1.0 | + | 1.0DNA 6-methylaminopurine |
| |
|
---|
Metabolites: | ECMDB ID | Name | View |
---|
ECMDB00939 | S-Adenosylhomocysteine | MetaboCard |
|
---|
GO Classification: | Function |
---|
binding | catalytic activity | methyltransferase activity | nucleic acid binding | S-adenosylmethionine-dependent methyltransferase activity | site-specific DNA-methyltransferase (adenine-specific) activity | transferase activity | transferase activity, transferring one-carbon groups | Process |
---|
cellular macromolecule metabolic process | cellular metabolic process | DNA alkylation | DNA metabolic process | DNA methylation | DNA modification | macromolecule metabolic process | metabolic process | methylation | one-carbon metabolic process |
|
---|
Gene Properties |
---|
Blattner: | b3387 |
---|
Gene Orientation | Counterclockwise |
---|
Centisome Percentage: | 75.72 |
---|
Left Sequence End | 3513099 |
---|
Right Sequence End | 3513935 |
---|
Gene Sequence: | >837 bp
ATGGAAATGCTCGAAGAGCACCGCTGTTTTGAAGGCTGGCAGCAACGCTGGCGACACGAC
TCCAGTACCTTAAACTGCCCGATGACGTTCAGTATCTTTCTCCCTCCACCTCGTGATCAC
ACTCCGCCACCAGTGCTGTACTGGCTTTCCGGATTAACCTGCAATGACGAGAACTTCACC
ACCAAGGCGGGTGCCCAGCGGGTAGCGGCGGAACTGGGGATTGTACTGGTGATGCCAGAC
ACCAGCCCGCGCGGCGAAAAGGTTGCCAACGACGATGGCTACGATTTAGGCCAGGGCGCA
GGCTTTTATCTTAATGCCACGCAACCGCCGTGGGCGACGCATTACCGGATGTATGATTAT
CTGCGCGATGAATTACCGGCGCTGGTTCAGTCGCAATTTAATGTCAGCGACCGCTGCGCC
ATTAGCGGTCACTCAATGGGTGGTCACGGTGCGCTGATTATGGCGCTGAAAAATCCGGGT
AAATACACCAGCGTTTCGGCCTTTGCGCCAATTGTGAATCCGTGCAGCGTCCCGTGGGGA
ATCAAAGCGTTTAGCAGCTATTTAGGTGAGGACAAAAATGCATGGCTGGAATGGGACAGT
TGCGCACTGATGTATGCCAGTAACGCGCAGGATGCGATCCCGACGCTTATCGATCAGGGC
GATAATGATCAGTTTCTTGCCGACCAGTTGCAACCTGCGGTACTGGCAGAAGCCGCGCGC
CAGAAAGCGTGGCCGATGACGCTGCGTATTCAGCCGGGATATGATCACAGTTACTACTTC
ATCGCCTCTTTTATAGAGGATCACCTGCGCTTCCATGCGCAGTATTTACTGAAGTGA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 278 |
---|
Protein Molecular Weight: | 32099 |
---|
Protein Theoretical pI: | 9 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >DNA adenine methylase
MKKNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRYILADINSDLI
SLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNKSQDPFRRAVLFLYLNRYGYN
GLCRYNLRGEFNVPFGRYKKPYFPEAELYHFAEKAQNAFFYCESYADSMARADDASVVYC
DPPYAPLSATANFTAYHTNSFTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRA
KLHVVKVRRSISSNGGTRKKVDELLALYKPGVVSPAKK |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Brooks, J. E., Blumenthal, R. M., Gingeras, T. R. (1983). "The isolation and characterization of the Escherichia coli DNA adenine methylase (dam) gene." Nucleic Acids Res 11:837-851. Pubmed: 6300769
- Guyot, J. B., Grassi, J., Hahn, U., Guschlbauer, W. (1993). "The role of the preserved sequences of Dam methylase." Nucleic Acids Res 21:3183-3190. Pubmed: 8341592
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Jonczyk, P., Hines, R., Smith, D. W. (1989). "The Escherichia coli dam gene is expressed as a distal gene of a new operon." Mol Gen Genet 217:85-96. Pubmed: 2549371
- Lyngstadaas, A., Lobner-Olesen, A., Boye, E. (1995). "Characterization of three genes in the dam-containing operon of Escherichia coli." Mol Gen Genet 247:546-554. Pubmed: 7603433
|
---|