ATP synthase protein I (P0ABC0)

Identification
Name:ATP synthase protein I
Synonyms:Not Available
Gene Name:atpI
Enzyme Class:Not Available
Biological Properties
General Function:Energy production and conversion
Specific Function:A possible function for this protein is to guide the assembly of the membrane sector of the ATPase enzyme complex
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
macromolecular complex
protein complex
proton-transporting ATP synthase complex, coupling factor F(o)
proton-transporting two-sector ATPase complex, proton-transporting domain
Function
cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
inorganic cation transmembrane transporter activity
ion transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
ATP biosynthetic process
ATP synthesis coupled proton transport
cellular nitrogen compound metabolic process
metabolic process
nitrogen compound metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleoside triphosphate biosynthetic process
purine nucleotide biosynthetic process
purine nucleotide metabolic process
purine ribonucleoside triphosphate biosynthetic process
Gene Properties
Blattner:b3739
Gene OrientationCounterclockwise
Centisome Percentage:84.49
Left Sequence End3920083
Right Sequence End3920463
Gene Sequence:
>381 bp
ATGTTACGTATATTTATCCCAACATCTAACGGTAAGATTTCCAGACGTCGTTATATATTT
TCATTTATTTTAATAAATTTCATTTTTGCCTTTCTTATTATCTTTTTTAACGATGGAGAA
GCAGGCTTTCTTGTTATAGTCTCTACCATCGTACTCCATTATCTCGTCATCAACATGAAT
TGCCAGCGACTCCGTGATAGTGGTTTCATCTATATAAAAACTTATGTTTTTGGTACATTA
GCAGTATATATCATCTCTATCATCACAATGATAGCCGAAGATTTTGCCTGTTCAGGCAAT
GGTTCGATGATTTTTTTGATTTGTTATTTTTCCACTTTCAGTATGCTAATGCTTGCACCT
ACTGATTCATCAAAACAATAG
Protein Properties
Pfam Domain Function:
Protein Residues:126
Protein Molecular Weight:13632
Protein Theoretical pI:12
Signaling Regions:
  • None
Transmembrane Regions:
  • 15-35
  • 38-58
  • 71-94
  • 101-117
Protein Sequence:
>ATP synthase protein I
MSVSLVSRNVARKLLLVQLLVVIASGLLFSLKDPFWGVSAISGGLAVFLPNVLFMIFAWR
HQAHTPAKGRVAWTFAFGEAFKVLAMLVLLVVALAVLKAVFLPLIVTWVLVLVVQILAPA
VINNKG
References
External Links:
ResourceLink
Uniprot ID:P0ABC0
Uniprot Name:ATPZ_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85676233
Ecogene ID:EG10106
Ecocyc:EG10106
ColiBase:b3739
Kegg Gene:b3739
EchoBASE ID:EB0104
CCDB:ATPZ_ECOLI
BacMap:90111645
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Daniels, D. L., Blattner, F. R. (1993). "DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication." Genomics 16:551-561. Pubmed: 7686882
  • Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
  • Gay, N. J. (1984). "Construction and characterization of an Escherichia coli strain with a uncI mutation." J Bacteriol 158:820-825. Pubmed: 6327640
  • Gay, N. J., Walker, J. E. (1981). "The atp operon: nucleotide sequence of the promoter and the genes for the membrane proteins, and the delta subunit of Escherichia coli ATP-synthase." Nucleic Acids Res 9:3919-3926. Pubmed: 6272190
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Kanazawa, H., Futai, M. (1982). "Structure and function of H+-ATPase: what we have learned from Escherichia coli H+-ATPase." Ann N Y Acad Sci 402:45-64. Pubmed: 6301339
  • Kanazawa, H., Mabuchi, K., Futai, M. (1982). "Nucleotide sequence of the promoter region of the gene cluster for proton-translocating ATPase from Escherichia coli and identification of the active promotor." Biochem Biophys Res Commun 107:568-575. Pubmed: 6215041
  • Nielsen, J., Hansen, F. G., Hoppe, J., Friedl, P., von Meyenburg, K. (1981). "The nucleotide sequence of the atp genes coding for the F0 subunits a, b, c and the F1 subunit delta of the membrane bound ATP synthase of Escherichia coli." Mol Gen Genet 184:33-39. Pubmed: 6278247
  • Nielsen, J., Jorgensen, B. B., van Meyenburg, K. V., Hansen, F. G. (1984). "The promoters of the atp operon of Escherichia coli K12." Mol Gen Genet 193:64-71. Pubmed: 6318052
  • Schneppe, B., Deckers-Hebestreit, G., Altendorf, K. (1990). "Overproduction and purification of the uncI gene product of the ATP synthase of Escherichia coli." J Biol Chem 265:389-395. Pubmed: 2136739
  • Walker, J. E., Gay, N. J., Saraste, M., Eberle, A. N. (1984). "DNA sequence around the Escherichia coli unc operon. Completion of the sequence of a 17 kilobase segment containing asnA, oriC, unc, glmS and phoS." Biochem J 224:799-815. Pubmed: 6395859
  • Walker, J. E., Saraste, M., Gay, N. J. (1984). "The unc operon. Nucleotide sequence, regulation and structure of ATP-synthase." Biochim Biophys Acta 768:164-200. Pubmed: 6206892