ATP synthase subunit b (P0ABA0)

Identification
Name:ATP synthase subunit b
Synonyms:
  • ATP synthase F(0) sector subunit b
  • ATPase subunit I
  • F-type ATPase subunit b
  • F-ATPase subunit b
Gene Name:atpF
Enzyme Class:Not Available
Biological Properties
General Function:Involved in hydrogen ion transmembrane transporter activity
Specific Function:Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0)
Cellular Location:Cell inner membrane; Single-pass membrane protein
SMPDB Pathways:
  • Oxidative phosphorylation PW000919
  • purine nucleotides de novo biosynthesis PW000910
  • purine nucleotides de novo biosynthesis 1435709748 PW000960
  • purine nucleotides de novo biosynthesis 2 PW002033
KEGG Pathways:
SMPDB Reactions:
1.0Adenosine diphosphate+1.0Thumb+4.0Thumb+1.0Thumb ↔ 1.0Thumb+3.0Thumb+1.0Thumb
1.0Adenosine diphosphate + 1.0Phosphate + 4.0Hydrogen ion + 1.0ADP ↔ 1.0Water + 3.0Hydrogen ion + 1.0Adenosine triphosphate
ReactionCard
Metabolites:
ECMDB IDNameView
ECMDB00538Adenosine triphosphateMetaboCard
ECMDB01341ADPMetaboCard
ECMDB21225Hydrogen ionMetaboCard
ECMDB01429PhosphateMetaboCard
ECMDB00494WaterMetaboCard
GO Classification:
Component
macromolecular complex
protein complex
proton-transporting ATP synthase complex, coupling factor F(o)
proton-transporting two-sector ATPase complex, proton-transporting domain
Function
cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
inorganic cation transmembrane transporter activity
ion transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
substrate-specific transmembrane transporter activity
transmembrane transporter activity
transporter activity
Process
ATP biosynthetic process
ATP synthesis coupled proton transport
cellular nitrogen compound metabolic process
metabolic process
nitrogen compound metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleoside triphosphate biosynthetic process
purine nucleotide biosynthetic process
purine nucleotide metabolic process
purine ribonucleoside triphosphate biosynthetic process
Gene Properties
Blattner:b3736
Gene OrientationCounterclockwise
Centisome Percentage:84.46
Left Sequence End3918441
Right Sequence End3918911
Gene Sequence:
>471 bp
ATGATTCAGTCACAAATTAACCGCAATATTCGTCTTGATCTTGCCGATGCCATTTTGCTC
AGCAAAGCTAAAAAAGATCTCTCATTTGCCGAGATTGCCGACGGCACCGGTCTGGCAGAA
GCCTTTGTAACCGCGGCTTTGCTGGGTCAGCAGGCGCTTCCTGCCGACGCCGCCCGCCTG
GTCGGGGCGAAGCTGGATCTCGACGAAGACTCCATTCTACTGTTGCAGATGATTCCACTG
CGTGGCTGCATTGATGACCGTATTCCAACTGACCCAACGATGTATCGTTTCTATGAAATG
TTGCAGGTGTACGGTACAACCCTGAAAGCGTTGGTTCATGAGAAATTTGGCGATGGCATT
ATTAGCGCGATTAACTTCAAACTCGACGTTAAGAAAGTGGCGGACCCGGAAGGTGGCGAA
CGTGCGGTCATCACCTTAGATGGTAAATATCTGCCGACCAAACCGTTCTGA
Protein Properties
Pfam Domain Function:
Protein Residues:156
Protein Molecular Weight:17264
Protein Theoretical pI:6
PDB File:1L2P
Signaling Regions:
  • None
Transmembrane Regions:
  • 11-31
Protein Sequence:
>ATP synthase subunit b
MNLNATILGQAIAFVLFVLFCMKYVWPPLMAAIEKRQKEIADGLASAERAHKDLDLAKAS
ATDQLKKAKAEAQVIIEQANKRRSQILDEAKAEAEQERTKIVAQAQAEIEAERKRAREEL
RKQVAILAVAGAEKIIERSVDEAANSDIVDKLVAEL
References
External Links:
ResourceLink
Uniprot ID:P0ABA0
Uniprot Name:ATPF_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674482
PDB ID:1L2P
Ecogene ID:EG10103
Ecocyc:EG10103
ColiBase:b3736
Kegg Gene:b3736
EchoBASE ID:EB0101
CCDB:ATPF_ECOLI
BacMap:16131604
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Burland, V., Plunkett, G. 3rd, Daniels, D. L., Blattner, F. R. (1993). "DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication." Genomics 16:551-561. Pubmed: 7686882
  • Dmitriev, O., Jones, P. C., Jiang, W., Fillingame, R. H. (1999). "Structure of the membrane domain of subunit b of the Escherichia coli F0F1 ATP synthase." J Biol Chem 274:15598-15604. Pubmed: 10336456
  • Gay, N. J., Walker, J. E. (1981). "The atp operon: nucleotide sequence of the promoter and the genes for the membrane proteins, and the delta subunit of Escherichia coli ATP-synthase." Nucleic Acids Res 9:3919-3926. Pubmed: 6272190
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Kanazawa, H., Futai, M. (1982). "Structure and function of H+-ATPase: what we have learned from Escherichia coli H+-ATPase." Ann N Y Acad Sci 402:45-64. Pubmed: 6301339
  • Kanazawa, H., Mabuchi, K., Kayano, T., Noumi, T., Sekiya, T., Futai, M. (1981). "Nucleotide sequence of the genes for F0 components of the proton-translocating ATPase from Escherichia coli: prediction of the primary structure of F0 subunits." Biochem Biophys Res Commun 103:613-620. Pubmed: 6277311
  • Mabuchi, K., Kanazawa, H., Kayano, T., Futai, M. (1981). "Nucleotide sequence of the gene coding for the delta subunit of proton translocating ATPase of Escherichia coli." Biochem Biophys Res Commun 102:172-179. Pubmed: 6458296
  • McCormick, K. A., Cain, B. D. (1991). "Targeted mutagenesis of the b subunit of F1F0 ATP synthase in Escherichia coli: Glu-77 through Gln-85." J Bacteriol 173:7240-7248. Pubmed: 1682301
  • Nielsen, J., Hansen, F. G., Hoppe, J., Friedl, P., von Meyenburg, K. (1981). "The nucleotide sequence of the atp genes coding for the F0 subunits a, b, c and the F1 subunit delta of the membrane bound ATP synthase of Escherichia coli." Mol Gen Genet 184:33-39. Pubmed: 6278247
  • Porter, A. C., Kumamoto, C., Aldape, K., Simoni, R. D. (1985). "Role of the b subunit of the Escherichia coli proton-translocating ATPase. A mutagenic analysis." J Biol Chem 260:8182-8187. Pubmed: 2861200
  • Stenberg, F., Chovanec, P., Maslen, S. L., Robinson, C. V., Ilag, L. L., von Heijne, G., Daley, D. O. (2005). "Protein complexes of the Escherichia coli cell envelope." J Biol Chem 280:34409-34419. Pubmed: 16079137
  • Walker, J. E., Gay, N. J., Saraste, M., Eberle, A. N. (1984). "DNA sequence around the Escherichia coli unc operon. Completion of the sequence of a 17 kilobase segment containing asnA, oriC, unc, glmS and phoS." Biochem J 224:799-815. Pubmed: 6395859