| Identification |
|---|
| Name: | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase |
|---|
| Synonyms: | - Tetrahydrodipicolinate N-succinyltransferase
- THDP succinyltransferase
- THP succinyltransferase
- Tetrahydropicolinate succinylase
|
|---|
| Gene Name: | dapD |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | Involved in 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase activity |
|---|
| Specific Function: | Succinyl-CoA + (S)-2,3,4,5-tetrahydropyridine- 2,6-dicarboxylate + H(2)O = CoA + N-succinyl-L-2-amino-6- oxoheptanedioate |
|---|
| Cellular Location: | Cytoplasm |
|---|
| SMPDB Pathways: | |
|---|
| KEGG Pathways: | |
|---|
| KEGG Reactions: | |
|---|
| SMPDB Reactions: | |
1.0 | + | 1.0Succinyl-CoA | + | 1.0 | + | 1.0 | → | 1.0 | + | 1.0 |
| |
|
|---|
| EcoCyc Reactions: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Component |
|---|
| cell part | | cytoplasm | | intracellular part | | Function |
|---|
| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase activity | | acyltransferase activity | | catalytic activity | | N-acyltransferase activity | | N-succinyltransferase activity | | transferase activity | | transferase activity, transferring acyl groups | | transferase activity, transferring acyl groups other than amino-acyl groups | | Process |
|---|
| aspartate family amino acid metabolic process | | cellular amino acid and derivative metabolic process | | cellular amino acid metabolic process | | cellular metabolic process | | lysine biosynthetic process | | lysine biosynthetic process via diaminopimelate | | lysine metabolic process | | metabolic process |
|
|---|
| Gene Properties |
|---|
| Blattner: | b0166 |
|---|
| Gene Orientation | Counterclockwise |
|---|
| Centisome Percentage: | 3.99 |
|---|
| Left Sequence End | 185123 |
|---|
| Right Sequence End | 185947 |
|---|
| Gene Sequence: | >825 bp
ATGCAGCAGTTACAGAACATTATTGAAACCGCTTTTGAACGCCGTGCCGAGATCACGCCA
GCCAATGCAGACACCGTTACCCGCGAAGCGGTAAATCAGGTGATCGCCCTGCTGGATTCC
GGCGCACTGCGTGTAGCGGAAAAAATTGACGGTCAGTGGGTGACGCATCAGTGGTTGAAA
AAAGCGGTGCTGCTCTCTTTCCGTATTAATGATAATCAGGTGATCGAAGGGGCAGAAAGC
CGCTACTTCGACAAAGTGCCGATGAAATTCGCCGACTACGACGAAGCACGTTTCCAGAAA
GAAGGCTTCCGCGTTGTGCCACCAGCGGCGGTACGTCAGGGTGCGTTTATTGCCCGTAAC
ACCGTGCTGATGCCGTCTTACGTCAACATCGGCGCATATGTTGATGAAGGCACCATGGTT
GATACCTGGGCGACCGTCGGTTCTTGTGCGCAGATTGGTAAAAACGTCCACCTTTCCGGT
GGCGTGGGCATCGGCGGCGTGCTGGAACCGCTGCAGGCTAACCCAACCATCATTGAAGAT
AATTGCTTCATCGGCGCGCGCTCTGAAGTGGTTGAAGGGGTGATTGTCGAAGAAGGTTCC
GTCATTTCCATGGGCGTATACATTGGTCAGAGCACCCGTATTTACGACCGTGAAACCGGC
GAAATCCACTACGGTCGCGTTCCGGCGGGGTCTGTGGTTGTTTCAGGTAATCTGCCGTCA
AAAGATGGCAAATACAGCCTCTACTGTGCGGTTATCGTTAAGAAAGTTGACGCGAAAACT
CGCGGCAAAGTCGGCATTAACGAACTGCTGCGTACCATCGACTAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 274 |
|---|
| Protein Molecular Weight: | 29892 |
|---|
| Protein Theoretical pI: | 5 |
|---|
| PDB File: | 1KGT |
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
MQQLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRVAEKIDGQWVTHQWLK
KAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQGAFIARN
TVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED
NCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVSGNLPS
KDGKYSLYCAVIVKKVDAKTRGKVGINELLRTID |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Fujita, N., Mori, H., Yura, T., Ishihama, A. (1994). "Systematic sequencing of the Escherichia coli genome: analysis of the 2.4-4.1 min (110,917-193,643 bp) region." Nucleic Acids Res 22:1637-1639. Pubmed: 8202364
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Link, A. J., Robison, K., Church, G. M. (1997). "Comparing the predicted and observed properties of proteins encoded in the genome of Escherichia coli K-12." Electrophoresis 18:1259-1313. Pubmed: 9298646
- Richaud, C., Richaud, F., Martin, C., Haziza, C., Patte, J. C. (1984). "Regulation of expression and nucleotide sequence of the Escherichia coli dapD gene." J Biol Chem 259:14824-14828. Pubmed: 6094577
- van Heeswijk, W. C., Rabenberg, M., Westerhoff, H. V., Kahn, D. (1993). "The genes of the glutamine synthetase adenylylation cascade are not regulated by nitrogen in Escherichia coli." Mol Microbiol 9:443-457. Pubmed: 8412694
|
|---|