| Identification |
|---|
| Name: | Orotate phosphoribosyltransferase |
|---|
| Synonyms: | |
|---|
| Gene Name: | pyrE |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | Involved in orotate phosphoribosyltransferase activity |
|---|
| Specific Function: | Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP) |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | |
|---|
| KEGG Pathways: | |
|---|
| KEGG Reactions: | |
|---|
| SMPDB Reactions: | |
1.0 | + | 1.0 | → | 1.0Pyrophosphate | + | 1.0 |
| |
|
|---|
| EcoCyc Reactions: | |
|---|
| Complex Reactions: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| catalytic activity | | orotate phosphoribosyltransferase activity | | transferase activity | | transferase activity, transferring glycosyl groups | | transferase activity, transferring pentosyl groups | | Process |
|---|
| cellular nitrogen compound metabolic process | | metabolic process | | nitrogen compound metabolic process | | nucleobase, nucleoside and nucleotide metabolic process | | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | | nucleoside metabolic process | | nucleoside phosphate metabolic process | | nucleotide metabolic process | | pyrimidine nucleotide biosynthetic process | | pyrimidine nucleotide metabolic process |
|
|---|
| Gene Properties |
|---|
| Blattner: | b3642 |
|---|
| Gene Orientation | Counterclockwise |
|---|
| Centisome Percentage: | 82.19 |
|---|
| Left Sequence End | 3813150 |
|---|
| Right Sequence End | 3813791 |
|---|
| Gene Sequence: | >642 bp
ATGCGCAGTAAGTATATCGTCATTGAGGGGCTGGAAGGCGCAGGCAAAACTACCGCGCGT
AATGTGGTGGTTGAGACGCTCGAGCAACTGGGTATCCGCGACATGGTTTTCACTCGGGAA
CCTGGCGGTACGCAACTTGCCGAAAAGTTAAGAAGCCTGGTGCTGGATATCAAATCGGTA
GGCGATGAAGTCATTACCGATAAAGCCGAAGTTCTGATGTTTTATGCCGCGCGCGTTCAA
CTGGTAGAAACGGTCATCAAACCAGCTCTGGCTAACGGCACCTGGGTGATTGGCGATCGC
CACGATCTCTCCACTCAGGCGTATCAGGGCGGCGGACGTGGTATTGACCAACATATGCTG
GCAACACTGCGTGATGCTGTTCTCGGGGATTTTCGCCCCGACTTAACGCTCTATCTCGAT
GTTACCCCGGAAGTTGGCTTAAAACGCGCGCGTGCGCGCGGCGAGCTGGATCGTATTGAG
CAAGAATCTTTCGATTTCTTTAATCGCACCCGCGCCCGCTATCTGGAACTGGCAGCACAA
GATAAAAGCATTCATACCATTGATGCCACCCAGCCGCTGGAGGCCGTGATGGATGCAATC
CGCACTACCGTGACCCACTGGGTGAAGGAGTTGGACGCATGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 213 |
|---|
| Protein Molecular Weight: | 23567 |
|---|
| Protein Theoretical pI: | 5 |
|---|
| PDB File: | 1ORO |
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Orotate phosphoribosyltransferase
MKPYQRQFIEFALSKQVLKFGEFTLKSGRKSPYFFNAGLFNTGRDLALLGRFYAEALVDS
GIEFDLLFGPAYKGIPIATTTAVALAEHHDLDLPYCFNRKEAKDHGEGGNLVGSALQGRV
MLVDDVITAGTAIRESMEIIQANGATLAGVLISLDRQERGRGEISAIQEVERDYNCKVIS
IITLKDLIAYLEEKPEMAEHLAAVKAYREEFGV |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Burland, V., Plunkett, G. 3rd, Daniels, D. L., Blattner, F. R. (1993). "DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication." Genomics 16:551-561. Pubmed: 7686882
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Henriksen, A., Aghajari, N., Jensen, K. F., Gajhede, M. (1996). "A flexible loop at the dimer interface is a part of the active site of the adjacent monomer of Escherichia coli orotate phosphoribosyltransferase." Biochemistry 35:3803-3809. Pubmed: 8620002
- Poulsen, P., Bonekamp, F., Jensen, K. F. (1984). "Structure of the Escherichia coli pyrE operon and control of pyrE expression by a UTP modulated intercistronic attentuation." EMBO J 3:1783-1790. Pubmed: 6207018
- Poulsen, P., Jensen, K. F., Valentin-Hansen, P., Carlsson, P., Lundberg, L. G. (1983). "Nucleotide sequence of the Escherichia coli pyrE gene and of the DNA in front of the protein-coding region." Eur J Biochem 135:223-229. Pubmed: 6349999
|
|---|