| Identification |
|---|
| Name: | Phosphopantetheine adenylyltransferase |
|---|
| Synonyms: | - Dephospho-CoA pyrophosphorylase
- Pantetheine-phosphate adenylyltransferase
- PPAT
|
|---|
| Gene Name: | coaD |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | Involved in catalytic activity |
|---|
| Specific Function: | Reversibly transfers an adenylyl group from ATP to 4'- phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate |
|---|
| Cellular Location: | Cytoplasm |
|---|
| SMPDB Pathways: | - Pantothenate and CoA biosynthesis PW000828
|
|---|
| KEGG Pathways: | |
|---|
| KEGG Reactions: | |
|---|
| SMPDB Reactions: | |
1.04'-phosphopantetheine | + | 1.0 | + | 1.0 | + | 1.0 | → | 1.0Pyrophosphate | + | 1.0 |
| |
|
|---|
| EcoCyc Reactions: | |
|---|
| Complex Reactions: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| adenylyltransferase activity | | catalytic activity | | nucleotidyltransferase activity | | pantetheine-phosphate adenylyltransferase activity | | transferase activity | | transferase activity, transferring phosphorus-containing groups | | Process |
|---|
| biosynthetic process | | cellular metabolic process | | coenzyme A biosynthetic process | | coenzyme biosynthetic process | | coenzyme metabolic process | | cofactor metabolic process | | metabolic process |
|
|---|
| Gene Properties |
|---|
| Blattner: | b3634 |
|---|
| Gene Orientation | Clockwise |
|---|
| Centisome Percentage: | 82.07 |
|---|
| Left Sequence End | 3807848 |
|---|
| Right Sequence End | 3808327 |
|---|
| Gene Sequence: | >480 bp
ATGATCAGTCTGATTGCGGCGTTAGCGGTAGATCGCGTTATCGGCATGGAAAACGCCATG
CCGTGGAACCTGCCTGCCGATCTCGCCTGGTTTAAACGCAACACCTTAAATAAACCCGTG
ATTATGGGCCGCCATACCTGGGAATCAATCGGTCGTCCGTTGCCAGGACGCAAAAATATT
ATCCTCAGCAGTCAACCGGGTACGGACGATCGCGTAACGTGGGTGAAGTCGGTGGATGAA
GCCATCGCGGCGTGTGGTGACGTACCAGAAATCATGGTGATTGGCGGCGGTCGCGTTTAT
GAACAGTTCTTGCCAAAAGCGCAAAAACTGTATCTGACGCATATCGACGCAGAAGTGGAA
GGCGACACCCATTTCCCGGATTACGAGCCGGATGACTGGGAATCGGTATTCAGCGAATTC
CACGATGCTGATGCGCAGAACTCTCACAGCTATTGCTTTGAGATTCTGGAGCGGCGGTAA
|
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 159 |
|---|
| Protein Molecular Weight: | 17837 |
|---|
| Protein Theoretical pI: | 7 |
|---|
| PDB File: | 1GN8 |
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Phosphopantetheine adenylyltransferase
MQKRAIYPGTFDPITNGHIDIVTRATQMFDHVILAIAASPSKKPMFTLEERVALAQQATA
HLGNVEVVGFSDLMANFARNQHATVLIRGLRAVADFEYEMQLAHMNRHLMPELESVFLMP
SKEWSFISSSLVKEVARHQGDVTHFLPENVHQALMAKLA |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Clementz, T., Raetz, C. R. (1991). "A gene coding for 3-deoxy-D-manno-octulosonic-acid transferase in Escherichia coli. Identification, mapping, cloning, and sequencing." J Biol Chem 266:9687-9696. Pubmed: 2033061
- Geerlof, A., Lewendon, A., Shaw, W. V. (1999). "Purification and characterization of phosphopantetheine adenylyltransferase from Escherichia coli." J Biol Chem 274:27105-27111. Pubmed: 10480925
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Izard, T. (2002). "The crystal structures of phosphopantetheine adenylyltransferase with bound substrates reveal the enzyme's catalytic mechanism." J Mol Biol 315:487-495. Pubmed: 11812124
- Izard, T., Geerlof, A. (1999). "The crystal structure of a novel bacterial adenylyltransferase reveals half of sites reactivity." EMBO J 18:2021-2030. Pubmed: 10205156
- Roncero, C., Casadaban, M. J. (1992). "Genetic analysis of the genes involved in synthesis of the lipopolysaccharide core in Escherichia coli K-12: three operons in the rfa locus." J Bacteriol 174:3250-3260. Pubmed: 1577693
- Sofia, H. J., Burland, V., Daniels, D. L., Plunkett, G. 3rd, Blattner, F. R. (1994). "Analysis of the Escherichia coli genome. V. DNA sequence of the region from 76.0 to 81.5 minutes." Nucleic Acids Res 22:2576-2586. Pubmed: 8041620
|
|---|