Identification |
---|
Name: | DNA polymerase III subunit epsilon |
---|
Synonyms: | Not Available |
---|
Gene Name: | dnaQ |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | Involved in DNA binding |
---|
Specific Function: | DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. The epsilon subunit contain the editing function and is a proofreading 3'-5' exonuclease |
---|
Cellular Location: | Cytoplasmic |
---|
SMPDB Pathways: | |
---|
KEGG Pathways: | |
---|
KEGG Reactions: | |
1.0 | + | 1.0DNA | ↔ | 1.0 | + | 1.0DNA |
| | |
1.0 | + | 1.0DNA | ↔ | 1.0 | + | 1.0DNA |
| | |
1.0 | + | 1.0DNA | ↔ | 1.0 | + | 1.0DNA |
| | |
1.0 | + | 1.0DNA | ↔ | 1.0 | + | 1.0DNA |
| | |
1.0Deoxynucleoside triphosphate | + | 1.0DNA | ↔ | 1.0 |
| |
|
---|
EcoCyc Reactions: | |
1.0DNAn | ? | 1.0a nucleoside monophosphate |
| |
|
---|
Metabolites: | |
---|
GO Classification: | Component |
---|
cell part | intracellular | Function |
---|
binding | catalytic activity | DNA binding | DNA polymerase activity | DNA-directed DNA polymerase activity | exonuclease activity | hydrolase activity | hydrolase activity, acting on ester bonds | nuclease activity | nucleic acid binding | nucleotidyltransferase activity | transferase activity | transferase activity, transferring phosphorus-containing groups | Process |
---|
cellular macromolecule metabolic process | DNA metabolic process | DNA replication | macromolecule metabolic process | metabolic process |
|
---|
Gene Properties |
---|
Blattner: | b0215 |
---|
Gene Orientation | Clockwise |
---|
Centisome Percentage: | 5.09 |
---|
Left Sequence End | 236067 |
---|
Right Sequence End | 236798 |
---|
Gene Sequence: | >732 bp
ATGAGCACTGCAATTACACGCCAGATCGTTCTCGATACCGAAACCACCGGTATGAACCAG
ATTGGTGCGCACTATGAAGGCCACAAGATCATTGAGATTGGTGCCGTTGAAGTGGTGAAC
CGTCGCCTGACGGGCAATAACTTCCATGTTTATCTCAAACCCGATCGGCTGGTGGATCCG
GAAGCCTTTGGCGTACATGGTATTGCCGATGAATTTTTGCTCGATAAGCCCACGTTTGCC
GAAGTAGCCGATGAGTTCATGGACTATATTCGCGGCGCGGAGTTGGTGATCCATAACGCA
GCGTTCGATATCGGCTTTATGGACTACGAGTTTTCGTTGCTTAAGCGCGATATTCCGAAG
ACCAATACTTTCTGTAAGGTCACCGATAGCCTTGCGGTGGCGAGGAAAATGTTTCCCGGT
AAGCGCAACAGCCTCGATGCGTTATGTGCTCGCTACGAAATAGATAACAGTAAACGAACG
CTGCACGGGGCATTACTCGATGCCCAGATCCTTGCGGAAGTTTATCTGGCGATGACCGGT
GGTCAAACGTCGATGGCTTTTGCGATGGAAGGAGAGACACAACAGCAACAAGGTGAAGCA
ACAATTCAGCGCATTGTACGTCAGGCAAGTAAGTTACGCGTTGTTTTTGCGACAGATGAA
GAGATTGCAGCTCATGAAGCCCGTCTCGATCTGGTGCAGAAGAAAGGCGGAAGTTGCCTC
TGGCGAGCATAA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 243 |
---|
Protein Molecular Weight: | 27099 |
---|
Protein Theoretical pI: | 6 |
---|
PDB File: | 1J54 |
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >DNA polymerase III subunit epsilon
MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTGNNFHVYLKPDRLVDP
EAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDIGFMDYEFSLLKRDIPK
TNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHGALLDAQILAEVYLAMTG
GQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDEEIAAHEARLDLVQKKGGSCL
WRA |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Cox, E. C., Horner, D. L. (1986). "DNA sequence and coding properties of mutD(dnaQ) a dominant Escherichia coli mutator gene." J Mol Biol 190:113-117. Pubmed: 3023634
- Hamdan, S., Carr, P. D., Brown, S. E., Ollis, D. L., Dixon, N. E. (2002). "Structural basis for proofreading during replication of the Escherichia coli chromosome." Structure 10:535-546. Pubmed: 11937058
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Maki, H., Horiuchi, T., Sekiguchi, M. (1983). "Structure and expression of the dnaQ mutator and the RNase H genes of Escherichia coli: overlap of the promoter regions." Proc Natl Acad Sci U S A 80:7137-7141. Pubmed: 6316347
- O'Donnell, M. (1992). "Accessory protein function in the DNA polymerase III holoenzyme from E. coli." Bioessays 14:105-111. Pubmed: 1575709
- Takano, K., Nakabeppu, Y., Maki, H., Horiuchi, T., Sekiguchi, M. (1986). "Structure and function of dnaQ and mutD mutators of Escherichia coli." Mol Gen Genet 205:9-13. Pubmed: 3540531
|
---|