| Identification |
|---|
| Name: | Adenine phosphoribosyltransferase |
|---|
| Synonyms: | |
|---|
| Gene Name: | apt |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | Involved in adenine phosphoribosyltransferase activity |
|---|
| Specific Function: | Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis |
|---|
| Cellular Location: | Cytoplasm |
|---|
| SMPDB Pathways: | - adenine and adenosine salvage III PW002072
|
|---|
| KEGG Pathways: | |
|---|
| KEGG Reactions: | |
|---|
| SMPDB Reactions: | |
1.0 | + | 1.0 | → | 1.0Pyrophosphate | + | 1.0 |
| |
|
|---|
| EcoCyc Reactions: | |
|---|
| Complex Reactions: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Component |
|---|
| cell part | | cytoplasm | | intracellular part | | Function |
|---|
| adenine phosphoribosyltransferase activity | | catalytic activity | | transferase activity | | transferase activity, transferring glycosyl groups | | transferase activity, transferring pentosyl groups | | Process |
|---|
| adenine salvage | | cellular aromatic compound metabolic process | | cellular metabolic process | | cellular nitrogen compound metabolic process | | metabolic process | | nitrogen compound metabolic process | | nucleobase metabolic process | | nucleobase, nucleoside and nucleotide metabolic process | | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process | | nucleoside metabolic process | | purine base biosynthetic process | | purine base metabolic process | | purine base salvage |
|
|---|
| Gene Properties |
|---|
| Blattner: | b0469 |
|---|
| Gene Orientation | Clockwise |
|---|
| Centisome Percentage: | 10.57 |
|---|
| Left Sequence End | 490636 |
|---|
| Right Sequence End | 491187 |
|---|
| Gene Sequence: | >552 bp
ATGTTGTTAGAACAGGGGTGGCTGGTTGGCGCGCGCCGCGTTCCCTCACCACATTACGAT
TGCCGCCCGGATGACGAAACACCCACCCTGCTGGTGGTGCACAATATTAGCCTGCCGCCA
GGCGAGTTTGGCGGTCCGTGGATCGACGCATTATTCACTGGAACTATTGATCCGCAGGCA
CATCCTTTCTTTGCTGAGATCGCCCATTTGCGCGTCTCCGCTCACTGTTTGATTCGCCGT
GATGGTGAAATAGTCCAGTATGTTCCTTTCGATAAACGTGCATGGCATGCGGGAGTCTCT
CAGTATCAGGGGCGCGAACGCTGCAATGATTTTTCTATTGGGATTGAGCTTGAAGGCACC
GATACGCTGGCGTATACCGATGCGCAGTATCAACAGCTTGCGGCGGTTACGCGGGCACTG
ATTGATTGCTATCCGGATATCGCTAAAAACATGACGGGCCATTGTGATATTGCGCCGGAT
CGGAAAACCGATCCCGGTCCTGCATTTGATTGGGCACGGTTTCGTGTGCTGGTCAGCAAG
GAGACAACATGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 183 |
|---|
| Protein Molecular Weight: | 19859 |
|---|
| Protein Theoretical pI: | 5 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Adenine phosphoribosyltransferase
MTATAQQLEYLKNSIKSIQDYPKPGILFRDVTSLLEDPKAYALSIDLLVERYKNAGITKV
VGTEARGFLFGAPVALGLGVGFVPVRKPGKLPRETISETYDLEYGTDQLEIHVDAIKPGD
KVLVVDDLLATGGTIEATVKLIRRLGGEVADAAFIINLFDLGGEQRLEKQGITSYSLVPF
PGH |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Flower, A. M., McHenry, C. S. (1986). "The adjacent dnaZ and dnaX genes of Escherichia coli are contained within one continuous open reading frame." Nucleic Acids Res 14:8091-8101. Pubmed: 3534795
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Hershey, H. V., Taylor, M. W. (1986). "Nucleotide sequence and deduced amino acid sequence of Escherichia coli adenine phosphoribosyltransferase and comparison with other analogous enzymes." Gene 43:287-293. Pubmed: 3527873
- Zhang, X., Zhu, L., Deutscher, M. P. (1998). "Oligoribonuclease is encoded by a highly conserved gene in the 3'-5' exonuclease superfamily." J Bacteriol 180:2779-2781. Pubmed: 9573169
|
|---|