Identification |
---|
Name: | tRNA-specific adenosine deaminase |
---|
Synonyms: | Not Available |
---|
Gene Name: | tadA |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | Energy production and conversion |
---|
Specific Function: | Deaminates adenosine-34 to inosine in tRNA-Arg2. Mutation in this protein makes E.coli resistant to the toxic proteins encoded by the gef gene family. Essential for cell viability |
---|
Cellular Location: | Cytoplasmic |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
KEGG Reactions: | | | |
1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00494/thumb.png) | ↔ | 1.0![Thumb](http://moldb.wishartlab.com/molecules/ECMDB00051/thumb.png) |
| |
|
---|
EcoCyc Reactions: | |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
binding | catalytic activity | cation binding | hydrolase activity | ion binding | metal ion binding | transition metal ion binding | zinc ion binding |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >504 bp
ATGCCGGGCAACAGCCCGCATTATGGGCGTTGGCCTCAACACGATTTTCCGCCATTTAAA
AAACTCAGGCCGCAGTCGGTAACCTCGCGCATACAGCCGGGCAGTGACGTCATCGTCTGC
GCGGAAATGGACGAACAGTGGGGATACGTCGGGGCTAAATCGCGCCAGCGCTGGCTGTTT
TACGCGTATGACAGGCTCCGGAAGACGGTTGTTGCGCACGTATTCGGTGAACGCACTATG
GCGACGCTGGGGCGTCTTATGAGCCTGCTGTCACCCTTTGACGTGGTGATATGGATGACG
GATGGCTGGCCGCTGTATGAATCCCGCCTGAAGGGAAAGCTGCACGTAATCAGCAAGCGA
TATACGCAGCGAATTGAGCGGTATAACCTGAATCTGAGGCAGCACCTGGCACGGCTGGGA
CGGAAGTCGCTGTCGTTCTCAAAATCGGTGGAGCTGCATGACAAAGTCATCGGGCATTAT
CTGAACATAAAACACTATCAATAA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 167 |
---|
Protein Molecular Weight: | 18717 |
---|
Protein Theoretical pI: | 8 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >tRNA-specific adenosine deaminase
MSEVEFSHEYWMRHALTLAKRAWDEREVPVGAVLVHNNRVIGEGWNRPIGRHDPTAHAEI
MALRQGGLVMQNYRLIDATLYVTLEPCVMCAGAMIHSRIGRVVFGARDAKTGAAGSLMDV
LHHPGMNHRVEITEGILADECAALLSDFFRMRRQEIKAQKKAQSSTD |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Poulsen, L. K., Larsen, N. W., Molin, S., Andersson, P. (1992). "Analysis of an Escherichia coli mutant strain resistant to the cell-killing function encoded by the gef gene family." Mol Microbiol 6:895-905. Pubmed: 1602968
- Wolf, J., Gerber, A. P., Keller, W. (2002). "tadA, an essential tRNA-specific adenosine deaminase from Escherichia coli." EMBO J 21:3841-3851. Pubmed: 12110595
|
---|