| Identification |
|---|
| Name: | Putative phosphotransferase enzyme IIB component sgcB |
|---|
| Synonyms: | - Putative PTS system EIIB component
|
|---|
| Gene Name: | sgcB |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | Involved in sugar:hydrogen symporter activity |
|---|
| Specific Function: | The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane |
|---|
| Cellular Location: | Cytoplasm (Probable) |
|---|
| SMPDB Pathways: | |
|---|
| KEGG Pathways: | - Amino sugar and nucleotide sugar metabolism ec00520
- Ascorbate and aldarate metabolism ec00053
- Fructose and mannose metabolism ec00051
- Galactose metabolism ec00052
- Glycolysis / Gluconeogenesis ec00010
- Metabolic pathways eco01100
- Microbial metabolism in diverse environments ec01120
- Pentose phosphate pathway ec00030
- Starch and sucrose metabolism ec00500
|
|---|
| KEGG Reactions: | |
1.0 | + | 1.0Protein N(pi)-phospho-L-histidine | ↔ | 1.0 | + | 1.0Protein histidine |
| | |
1.0Protein N(pi)-phospho-L-histidine | + | 1.0Sugar | ↔ | 1.0Protein histidine | + | 1.0 |
| |
|
|---|
| Complex Reactions: | |
1.0Protein EIIB N(pi)-phospho-L-histidine/cysteine | + | 1.0 | → | 1.0protein EIIB | + | 1.0sugar phosphate |
| 1.0Protein EIIB N(pi)-phospho-L-histidine/cysteine + 1.0 Sucrose → 1.0protein EIIB + 1.0sugar phosphate ReactionCard |
|
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| carbohydrate transmembrane transporter activity | | cation transmembrane transporter activity | | cation:sugar symporter activity | | ion transmembrane transporter activity | | protein-N(PI)-phosphohistidine-sugar phosphotransferase activity | | solute:cation symporter activity | | substrate-specific transmembrane transporter activity | | sugar:hydrogen symporter activity | | transmembrane transporter activity | | transporter activity | | Process |
|---|
| carbohydrate transport | | establishment of localization | | phosphoenolpyruvate-dependent sugar phosphotransferase system | | transport |
|
|---|
| Gene Properties |
|---|
| Blattner: | b4565 |
|---|
| Gene Orientation | Counterclockwise |
|---|
| Centisome Percentage: | 97.60 |
|---|
| Left Sequence End | 4528278 |
|---|
| Right Sequence End | 4528556 |
|---|
| Gene Sequence: | >279 bp
ATGAATCGGCCAGCAATATTAAAAAAGAAAGCAGCCAAAGATGTTGCTTCAGTATTAAAA
ATAATATTTTTATTTTATTTGTTCCTCATAGCTAGATTAAAACAACGTTATTCGATACGT
GAAATTAAGAGGGATTTATGGAACATCAGAGAAAACTATTCCAGCAACGCGGCTATAGCG
AAGATCTATTGCCGAAAACGCAAAGCCAGCGGACCTGGAAAACATTTAACTATTTTACCT
TATGGATGGGTTCGGTTCATAACGTTCCCAATTATGTGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 92 |
|---|
| Protein Molecular Weight: | 9803 |
|---|
| Protein Theoretical pI: | 6 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Putative phosphotransferase enzyme IIB component sgcB
MKKILVACGTGMSTSTMIAHKLQEFLTEQGISATTAQCCLNEIPLNCNGMDLIVTSMRTN
SDYGIPTLNGAALLTGINDDALKQQIKALLTQ |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
|
|---|