Identification |
---|
Name: | Putative phosphotransferase IIA component sgcA |
---|
Synonyms: | - Putative PTS system EIIA component
|
---|
Gene Name: | sgcA |
---|
Enzyme Class: | |
---|
Biological Properties |
---|
General Function: | Involved in transporter activity |
---|
Specific Function: | The phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS), a major carbohydrate active -transport system, catalyzes the phosphorylation of incoming sugar substrates concomitantly with their translocation across the cell membrane |
---|
Cellular Location: | Cytoplasm (Probable) |
---|
SMPDB Pathways: | |
---|
KEGG Pathways: | - Amino sugar and nucleotide sugar metabolism ec00520
- Ascorbate and aldarate metabolism ec00053
- Fructose and mannose metabolism ec00051
- Galactose metabolism ec00052
- Glycolysis / Gluconeogenesis ec00010
- Metabolic pathways eco01100
- Microbial metabolism in diverse environments ec01120
- Pentose phosphate pathway ec00030
- Starch and sucrose metabolism ec00500
|
---|
KEGG Reactions: | |
1.0 | + | 1.0Protein N(pi)-phospho-L-histidine | ↔ | 1.0 | + | 1.0Protein histidine |
| | |
1.0Protein N(pi)-phospho-L-histidine | + | 1.0Sugar | ↔ | 1.0Protein histidine | + | 1.0 |
| |
|
---|
Complex Reactions: | |
1.0Protein EIIA N(pi)-phospho-L-histidine | + | 1.0protein EIIB | → | 1.0protein EIIA | + | 1.0protein EIIB N(pi)-phospho-L-histidine/cysteine |
| 1.0Protein EIIA N(pi)-phospho-L-histidine + 1.0protein EIIB → 1.0protein EIIA + 1.0protein EIIB N(pi)-phospho-L-histidine/cysteine ReactionCard |
|
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
cation transmembrane transporter activity | cation:sugar symporter activity | ion transmembrane transporter activity | solute:cation symporter activity | substrate-specific transmembrane transporter activity | sugar:hydrogen symporter activity | transmembrane transporter activity | transporter activity | Process |
---|
carbohydrate transport | establishment of localization | phosphoenolpyruvate-dependent sugar phosphotransferase system | transport |
|
---|
Gene Properties |
---|
Blattner: | b4302 |
---|
Gene Orientation | Counterclockwise |
---|
Centisome Percentage: | 97.54 |
---|
Left Sequence End | 4525572 |
---|
Right Sequence End | 4526003 |
---|
Gene Sequence: | >432 bp
ATGACAATCCATAAGAAAGGTCAGGCACACTGGGAAGGCGATATCAAACGCGGGAAGGGA
ACAGTATCCACCGAGAGTGGCGTGCTGAACCAACAGCCGTATGGATTTAACACGCGTTTT
GAAGGCGAAAAAGGAACCAACCCTGAAGAACTGATTGGCGCAGCGCATGCCGCATGTTTC
TCAATGGCGCTTTCATTAATGCTGGGGGAAGCGGGATTCACGCCAACATCGATTGATACC
ACCGCCGATGTGTCGCTGGATAAAGTGGATGCCGGTTTTGCGATTACGAAAATCGCACTG
AAGAGTGAAGTTGCGGTGCCGGGTATTGATGCCTCTACCTTTGACGGCATAATCCAGAAA
GCAAAAGCAGGATGCCCGGTCTCTCAGGTACTGAAAGCGGAAATTACGCTGGATTACCAG
TTGAAATCGTAA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 143 |
---|
Protein Molecular Weight: | 15638 |
---|
Protein Theoretical pI: | 5 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Putative phosphotransferase IIA component sgcA
MINDIKWVQAQRKATDWRQAVEIATRPLVAYGAAQPCYVNGIIENTLNWGPYYLIAPGIA
LPHARPEQGANYNQVSITTLRTPVAFGNEECDPVWLLLCVSATDANAHILTIQRISQFID
SPQRLTAVGNASTDDALFALVSG |
---|
References |
---|
External Links: | |
---|
General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L., Blattner, F. R. (1995). "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes." Nucleic Acids Res 23:2105-2119. Pubmed: 7610040
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
|
---|