Identification |
---|
Name: | Arginine exporter protein ArgO |
---|
Synonyms: | Not Available |
---|
Gene Name: | argO |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | Involved in amino acid transport |
---|
Specific Function: | Involved in the export of arginine. Important to control the intracellular level of arginine and the correct balance between arginine and lysine. May also be involved in the export of canavanine (a plant-derived antimetabolite) |
---|
Cellular Location: | Cell inner membrane; Multi-pass membrane protein |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Transports: | |
---|
Transport References: | - Orth, J. D., Conrad, T. M., Na, J., Lerman, J. A., Nam, H., Feist, A. M., Palsson, B. O. (2011). "A comprehensive genome-scale reconstruction of Escherichia coli metabolism--2011." Mol Syst Biol 7:535. Pubmed: 21988831
|
---|
Metabolites: | |
---|
GO Classification: | Component |
---|
cell part | integral to membrane | intrinsic to membrane | membrane | membrane part | Process |
---|
amine transport | amino acid transport | establishment of localization | transport |
|
---|
Gene Properties |
---|
Blattner: | b2923 |
---|
Gene Orientation | Counterclockwise |
---|
Centisome Percentage: | 66.09 |
---|
Left Sequence End | 3066195 |
---|
Right Sequence End | 3066830 |
---|
Gene Sequence: | >636 bp
ATGAATAAAGCAAAACGCCTGGAGATCCTCACTCGCCTGCGTGAGAACAATCCTCATCCC
ACCACCGAGCTTAATTTCAGTTCGCCTTTTGAATTGCTGATTGCCGTACTGCTTTCCGCT
CAGGCGACCGATGTCAGTGTTAATAAGGCGACGGCGAAACTCTACCCGGTGGCGAATACG
CCTGCAGCGATGCTTGAACTGGGCGTTGAAGGGGTGAAAACCTATATCAAAACGATTGGG
CTTTATAACAGCAAAGCAGAAAATATCATCAAAACCTGCCGTATCTTGCTGGAGCAGCAT
AATGGCGAGGTTCCGGAAGATCGTGCTGCGCTTGAAGCCCTGCCCGGCGTAGGTCGTAAA
ACAGCCAACGTCGTATTAAACACTGCATTCGGCTGGCCGACTATTGCTGTCGACACGCAC
ATTTTCCGCGTTTGTAATCGTACTCAATTTGCGCCGGGGAAAAACGTCGAACAGGTAGAA
GAAAAGCTACTGAAAGTGGTTCCAGCAGAGTTTAAAGTCGACTGCCACCATTGGTTGATC
CTGCACGGGCGTTATACCTGCATTGCCCGCAAGCCCCGCTGTGGCTCTTGTATTATTGAA
GATCTTTGTGAATACAAAGAGAAAGTTGACATCTGA |
---|
Protein Properties |
---|
Pfam Domain Function: | |
---|
Protein Residues: | 211 |
---|
Protein Molecular Weight: | 23175 |
---|
Protein Theoretical pI: | 10 |
---|
Signaling Regions: | |
---|
Transmembrane Regions: | - 1-21
- 37-57
- 68-88
- 111-131
- 147-167
- 179-199
|
---|
Protein Sequence: | >Arginine exporter protein ArgO
MFSYYFQGLALGAAMILPLGPQNAFVMNQGIRRQYHIMIALLCAISDLVLICAGIFGGSA
LLMQSPWLLALVTWGGVAFLLWYGFGAFKTAMSSNIELASAEVMKQGRWKIIATMLAVTW
LNPHVYLDTFVVLGSLGGQLDVEPKRWFALGTISASFLWFFGLALLAAWLAPRLRTAKAQ
RIINLVVGCVMWFIALQLARDGIAHAQALFS |
---|
References |
---|
External Links: | |
---|
General Reference: | - Alefounder, P. R., Perham, R. N. (1989). "Identification, molecular cloning and sequence analysis of a gene cluster encoding the class II fructose 1,6-bisphosphate aldolase, 3-phosphoglycerate kinase and a putative second glyceraldehyde 3-phosphate dehydrogenase of Escherichia coli." Mol Microbiol 3:723-732. Pubmed: 2546007
- Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Nandineni, M. R., Gowrishankar, J. (2004). "Evidence for an arginine exporter encoded by yggA (argO) that is regulated by the LysR-type transcriptional regulator ArgP in Escherichia coli." J Bacteriol 186:3539-3546. Pubmed: 15150242
|
---|