
Putative arsenate reductase (P0CF87)
Identification | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Name: | Putative arsenate reductase | ||||||||||||
Synonyms: |
| ||||||||||||
Gene Name: | yfjU | ||||||||||||
Enzyme Class: | |||||||||||||
Biological Properties | |||||||||||||
General Function: | Inorganic ion transport and metabolism | ||||||||||||
Specific Function: | Reduction of arsenate [As(V)] to arsenite [As(III)]. This protein expands the substrate specificity of arsAB pump which can extrude arsenite and antimonite to allow for arsenate pumping and resistance | ||||||||||||
Cellular Location: | Not Available | ||||||||||||
SMPDB Pathways: | Not Available | ||||||||||||
KEGG Pathways: | Not Available | ||||||||||||
Complex Reactions: | |||||||||||||
Metabolites: |
| ||||||||||||
GO Classification: | Not Available | ||||||||||||
Gene Properties | |||||||||||||
Blattner: | Not Available | ||||||||||||
Gene Orientation | Not Available | ||||||||||||
Centisome Percentage: | Not Available | ||||||||||||
Left Sequence End | Not Available | ||||||||||||
Right Sequence End | Not Available | ||||||||||||
Gene Sequence: | Not Available | ||||||||||||
Protein Properties | |||||||||||||
Pfam Domain Function: |
| ||||||||||||
Protein Residues: | 104 | ||||||||||||
Protein Molecular Weight: | 11823 | ||||||||||||
Protein Theoretical pI: | 7 | ||||||||||||
Signaling Regions: |
| ||||||||||||
Transmembrane Regions: |
| ||||||||||||
Protein Sequence: | >Putative arsenate reductase MSNITIYHNPACGTSRNTLEMLHNNGNEPTIINYLDMPPTRDELIKLISDIFSDKIIECI REQCHLMPALSLNVIGHVDIRSIHSYLFNFNEKVSPSHGFIKNG | ||||||||||||
References | |||||||||||||
External Links: |
| ||||||||||||
General Reference: |
|