| Identification |
|---|
| Name: | Putative arsenate reductase |
|---|
| Synonyms: | |
|---|
| Gene Name: | yfjU |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | Inorganic ion transport and metabolism |
|---|
| Specific Function: | Reduction of arsenate [As(V)] to arsenite [As(III)]. This protein expands the substrate specificity of arsAB pump which can extrude arsenite and antimonite to allow for arsenate pumping and resistance |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Complex Reactions: | |
1.0 | + | 1.0glutaredoxin | → | 1.0 | + | 1.0glutaredoxin disulfide | + | 1.0 |
| |
|
|---|
| Metabolites: | |
|---|
| GO Classification: | Not Available |
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | Not Available |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 104 |
|---|
| Protein Molecular Weight: | 11823 |
|---|
| Protein Theoretical pI: | 7 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Putative arsenate reductase
MSNITIYHNPACGTSRNTLEMLHNNGNEPTIINYLDMPPTRDELIKLISDIFSDKIIECI
REQCHLMPALSLNVIGHVDIRSIHSYLFNFNEKVSPSHGFIKNG |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Yamamoto, Y., Aiba, H., Baba, T., Hayashi, K., Inada, T., Isono, K., Itoh, T., Kimura, S., Kitagawa, M., Makino, K., Miki, T., Mitsuhashi, N., Mizobuchi, K., Mori, H., Nakade, S., Nakamura, Y., Nashimoto, H., Oshima, T., Oyama, S., Saito, N., Sampei, G., Satoh, Y., Sivasundaram, S., Tagami, H., Horiuchi, T., et, a. l. .. (1997). "Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features." DNA Res 4:91-113. Pubmed: 9205837
|
|---|
