| Identification |
|---|
| Name: | Ribosomal-protein-alanine acetyltransferase |
|---|
| Synonyms: | - Acetylating enzyme for N-terminal of ribosomal protein S18
|
|---|
| Gene Name: | rimI |
|---|
| Enzyme Class: | |
|---|
| Biological Properties |
|---|
| General Function: | Involved in N-acetyltransferase activity |
|---|
| Specific Function: | This enzyme acetylates the N-terminal alanine of ribosomal protein S18 |
|---|
| Cellular Location: | Cytoplasm |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| KEGG Reactions: | |
1.0 | + | 1.0Ribosomal-protein L-alanine | ↔ | 1.0 | + | 1.0Ribosomal-protein N-acetyl-L-alanine |
| |
|
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| acetyltransferase activity | | acyltransferase activity | | catalytic activity | | N-acetyltransferase activity | | transferase activity | | transferase activity, transferring acyl groups | | transferase activity, transferring acyl groups other than amino-acyl groups | | Process |
|---|
| macromolecule metabolic process | | macromolecule modification | | metabolic process | | N-terminal protein amino acid acetylation | | protein amino acid acetylation | | protein amino acid acylation | | protein modification process |
|
|---|
| Gene Properties |
|---|
| Blattner: | b4373 |
|---|
| Gene Orientation | Clockwise |
|---|
| Centisome Percentage: | 99.28 |
|---|
| Left Sequence End | 4606208 |
|---|
| Right Sequence End | 4606654 |
|---|
| Gene Sequence: | >447 bp
ATGAGCGATGTACCTTTCTGGCAAAGTAAAACCCTGGACGAAATGAGCGATGCGGAATGG
GAGTCGTTGTGTGATGGTTGCGGTCAGTGTTGCCTGCATAAACTGATGGATGAAGACACC
GACGAAATCTACTTCACTAACGTCGCCTGTCGCCAGCTCAATATTAAAACCTGTCAATGT
CGGAACTACGAACGTCGTTTCGAGTTTGAACCCGACTGCATTAAATTAACCCGTGAAAAT
CTGCCAACATTCGAATGGCTGCCAATGACCTGCGCTTATCGTTTGCTGGCGGAAGGTAAA
GATTTACCTGCGTGGCATCCGCTACTTACTGGTTCGAAAGCGGCAATGCATGGTGAACGT
ATCTCTGTGCGTCATATCGCAGTGAAAGAATCAGAAGTGATTGACTGGCAGGATCATATC
TTAAATAAACCTGACTGGGCGCAGTGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 148 |
|---|
| Protein Molecular Weight: | 16610 |
|---|
| Protein Theoretical pI: | 5 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Ribosomal-protein-alanine acetyltransferase
MNTISSLETTDLPAAYHIEQRAHAFPWSEKTFASNQGERYLNFQLTQNGKMAAFAITQVV
LDEATLFNIAVDPDYQRQGLGRALLEHLIDELEKRGVATLWLEVRASNAAAIALYESLGF
NEATIRRNYYPTTDGREDAIIMALPISM |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Burland, V., Plunkett, G. 3rd, Sofia, H. J., Daniels, D. L., Blattner, F. R. (1995). "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes." Nucleic Acids Res 23:2105-2119. Pubmed: 7610040
- Carter, J. R., Franden, M. A., Aebersold, R., McHenry, C. S. (1993). "Identification, isolation, and overexpression of the gene encoding the psi subunit of DNA polymerase III holoenzyme." J Bacteriol 175:5604-5610. Pubmed: 8366044
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Yoshikawa, A., Isono, S., Sheback, A., Isono, K. (1987). "Cloning and nucleotide sequencing of the genes rimI and rimJ which encode enzymes acetylating ribosomal proteins S18 and S5 of Escherichia coli K12." Mol Gen Genet 209:481-488. Pubmed: 2828880
|
|---|