| Identification |
|---|
| Name: | Porin ompL |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | ompL |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | Involved in porin activity |
|---|
| Specific Function: | Outer membrane channel protein that allows an efficient diffusion of low-molecular-weight solutes such as small sugars and tetraglycine. However, the specific substrate recognized by the ompL channel is unknown |
|---|
| Cellular Location: | Cell outer membrane |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Transports: | |
|---|
| Transport References: | - Orth, J. D., Conrad, T. M., Na, J., Lerman, J. A., Nam, H., Feist, A. M., Palsson, B. O. (2011). "A comprehensive genome-scale reconstruction of Escherichia coli metabolism--2011." Mol Syst Biol 7:535. Pubmed: 21988831
|
|---|
| Metabolites: | |
|---|
| GO Classification: | Not Available |
|---|
| Gene Properties |
|---|
| Blattner: | b3875 |
|---|
| Gene Orientation | Counterclockwise |
|---|
| Centisome Percentage: | 87.54 |
|---|
| Left Sequence End | 4061626 |
|---|
| Right Sequence End | 4062318 |
|---|
| Gene Sequence: | >693 bp
ATGATGACTAAAATAAAGTTATTGATGCTCATTATATTTTATTTAATCATTTCGGCCAGC
GCCCATGCTGCCGGAGGGATCGCATTAGGTGCCACGCGTATTATTTATCCCGCTGATGCT
AAACAGACTGCGGTATGGATTAGAAATAGCCATACCAATGAGCGCTTTCTGGTCAATTCG
TGGATTGAAAACAGCAGCGGTGTAAAAGAAAAGTCATTCATCATTACACCGCCACTGTTT
GTTAGTGAACCCAAAAGCGAAAATACTTTGCGTATTATTTACACCGGTCCACCGCTGGCA
GCAGATCGTGAGTCTCTGTTCTGGATGAATGTTAAGACGATCCCTTCGGTAGATAAAAAT
GCATTGAACGGCAGGAATGTTTTGCAACTGGCGATTTTATCGCGCATGAAATTATTTCTC
CGTCCAATTCAATTACAAGAATTACCCGCAGAAGCGCCGGACACACTCAAGTTTTCGCGA
TCCGGTAACTATATCAATGTTCATAATCCATCACCTTTTTATGTCACCCTGGTTAACTTA
CAAGTGGGCAGCCAAAAGTTGGGGAATGCTATGGCTGCACCCAGAGTTAATTCACAAATT
CCCTTACCCTCAGGAGTGCAGGGAAAGCTGAAATTTCAGACCGTTAATGATTATGGTTCA
GTAACTCCGGTCAGAGAAGTGAACTTAAACTAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 230 |
|---|
| Protein Molecular Weight: | 27200 |
|---|
| Protein Theoretical pI: | 6 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Porin ompL
MKKINAIILLSSLTSASVFAGAYVENREAYNLASDQGEVMLRVGYNFDMGAGIMLTNTYN
FQREDELKHGYNEIEGWYPLFKPTDKLTIQPGGLINDKSIGSGGAVYLDVNYKFVPWFNL
TVRNRYNHNNYSSTDLSGELDNNDTYEIGTYWNFKITDKFSYTFEPHYFMRVNDFNSSNG
KDHHWEITNTFRYRINEHWLPYFELRWLDRNVEPYHREQNQIRIGTKYFF |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Dartigalongue, C., Nikaido, H., Raina, S. (2000). "Protein folding in the periplasm in the absence of primary oxidant DsbA: modulation of redox potential in periplasmic space via OmpL porin." EMBO J 19:5980-5988. Pubmed: 11080145
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Plunkett, G. 3rd, Burland, V., Daniels, D. L., Blattner, F. R. (1993). "Analysis of the Escherichia coli genome. III. DNA sequence of the region from 87.2 to 89.2 minutes." Nucleic Acids Res 21:3391-3398. Pubmed: 8346018
- Sardesai, A. A., Genevaux, P., Schwager, F., Ang, D., Georgopoulos, C. (2003). "The OmpL porin does not modulate redox potential in the periplasmic space of Escherichia coli." EMBO J 22:1461-1466. Pubmed: 12660153
|
|---|
