| Identification |
|---|
| Name: | Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF |
|---|
| Synonyms: | - L-Ara4N-phosphoundecaprenol flippase subunit ArnF
- Undecaprenyl phosphate-aminoarabinose flippase subunit ArnF
|
|---|
| Gene Name: | arnF |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | Carbohydrate transport and metabolism |
|---|
| Specific Function: | Translocates 4-amino-4-deoxy-L-arabinose- phosphoundecaprenol (alpha-L-Ara4N-phosphoundecaprenol) from the cytoplasmic to the periplasmic side of the inner membrane |
|---|
| Cellular Location: | Cell inner membrane; Multi-pass membrane protein |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | - Cationic antimicrobial peptide (CAMP) resistance eco01503
|
|---|
| Transports: | |
|---|
| Transport References: | - Orth, J. D., Conrad, T. M., Na, J., Lerman, J. A., Nam, H., Feist, A. M., Palsson, B. O. (2011). "A comprehensive genome-scale reconstruction of Escherichia coli metabolism--2011." Mol Syst Biol 7:535. Pubmed: 21988831
|
|---|
| Metabolites: | | ECMDB ID | Name | View |
|---|
| ECMDB21364 | undecaprenyl phosphate-4-amino-4-deoxy-L-arabinose | MetaboCard |
|
|---|
| GO Classification: | Not Available |
|---|
| Gene Properties |
|---|
| Blattner: | b2258 |
|---|
| Gene Orientation | Clockwise |
|---|
| Centisome Percentage: | 51.10 |
|---|
| Left Sequence End | 2370914 |
|---|
| Right Sequence End | 2371300 |
|---|
| Gene Sequence: | >387 bp
ATGGGCCTGATGTGGGGATTATTCAGCGTCATTATTGCCTCAGTTGCGCAATTAAGCCTG
GGTTTTGCGGCGAGTCATCTGCCGCCGATGACGCACTTATGGGATTTTATCGCGGCTCTG
TTAGCTTTTGGCCTGGATGCCCGGATACTGTTACTCGGGCTGCTGGGTTATCTGCTTTCC
GTTTTTTGTTGGTATAAAACGCTTCATAAACTTGCGCTAAGCAAAGCCTATGCCTTGCTC
AGTATGAGTTATGTGCTGGTATGGATTGCTTCAATGGTACTTCCCGGCTGGGAAGGGACT
TTTTCGCTGAAAGCACTACTGGGAGTAGCCTGTATTATGAGCGGGTTGATGCTGATTTTC
CTGCCCACGACAAAACAACGTTACTGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 128 |
|---|
| Protein Molecular Weight: | 14085 |
|---|
| Protein Theoretical pI: | 10 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Probable 4-amino-4-deoxy-L-arabinose-phosphoundecaprenol flippase subunit ArnF
MGLMWGLFSVIIASVAQLSLGFAASHLPPMTHLWDFIAALLAFGLDARILLLGLLGYLLS
VFCWYKTLHKLALSKAYALLSMSYVLVWIASMVLPGWEGTFSLKALLGVACIMSGLMLIF
LPTTKQRY |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Sharma, V., Hudspeth, M. E., Meganathan, R. (1996). "Menaquinone (vitamin K2) biosynthesis: localization and characterization of the menE gene from Escherichia coli." Gene 168:43-48. Pubmed: 8626063
- Winfield, M. D., Groisman, E. A. (2004). "Phenotypic differences between Salmonella and Escherichia coli resulting from the disparate regulation of homologous genes." Proc Natl Acad Sci U S A 101:17162-17167. Pubmed: 15569938
- Yan, A., Guan, Z., Raetz, C. R. (2007). "An undecaprenyl phosphate-aminoarabinose flippase required for polymyxin resistance in Escherichia coli." J Biol Chem 282:36077-36089. Pubmed: 17928292
|
|---|