| Identification |
|---|
| Name: | Sec-independent protein translocase protein TatA |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | tatA |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | protein transport by the Tat complex |
|---|
| Specific Function: | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| integral component of membrane | | integral component of plasma membrane | | protein secretion | | protein transport by the Tat complex | | protein transporter activity | | proton motive force dependent protein transmembrane transporter activity | | TAT protein transport complex |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >270
atgggtggtatcagtatttggcagttattgattattgccgtcatcgttgtactgcttttt
ggcaccaaaaagctcggctccatcggttccgatcttggtgcgtcgatcaaaggctttaaa
aaagcaatgagcgatgatgaaccaaagcaggataaaaccagtcaggatgctgattttact
gcgaaaactatcgccgataagcaggcggatacgaatcaggaacaggctaaaacagaagac
gcgaagcgccacgataaagagcaggtgtaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 89 |
|---|
| Protein Molecular Weight: | 9663 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2LZR |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Sec-independent protein translocase protein TatA
MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFT
AKTIADKQADTNQEQAKTEDAKRHDKEQV |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|