Identification |
---|
Name: | Sec-independent protein translocase protein TatA |
---|
Synonyms: | Not Available |
---|
Gene Name: | tatA |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | protein transport by the Tat complex |
---|
Specific Function: | Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin-arginine motif in their signal peptide across membranes. TatA could form the protein-conducting channel of the Tat system. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
integral component of membrane | integral component of plasma membrane | protein secretion | protein transport by the Tat complex | protein transporter activity | proton motive force dependent protein transmembrane transporter activity | TAT protein transport complex |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >270
atgggtggtatcagtatttggcagttattgattattgccgtcatcgttgtactgcttttt
ggcaccaaaaagctcggctccatcggttccgatcttggtgcgtcgatcaaaggctttaaa
aaagcaatgagcgatgatgaaccaaagcaggataaaaccagtcaggatgctgattttact
gcgaaaactatcgccgataagcaggcggatacgaatcaggaacaggctaaaacagaagac
gcgaagcgccacgataaagagcaggtgtaa |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 89 |
---|
Protein Molecular Weight: | 9663 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 2LZR |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | |
---|
Protein Sequence: | >Sec-independent protein translocase protein TatA
MGGISIWQLLIIAVIVVLLFGTKKLGSIGSDLGASIKGFKKAMSDDEPKQDKTSQDADFT
AKTIADKQADTNQEQAKTEDAKRHDKEQV |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|