Identification |
---|
Name: | Outer membrane lipoprotein RcsF |
---|
Synonyms: | Not Available |
---|
Gene Name: | rcsF |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | intracellular signal transduction |
---|
Specific Function: | Essential component of the Rcs signaling system, which controls transcription of numerous genes. Plays a role in signal transduction from the cell surface to the histidine kinase RcsC. May detect outer membrane defects. The system controls expression of genes involved in colanic acid capsule synthesis, biofilm formation and cell division. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
anchored component of periplasmic side of cell outer membrane | cell outer membrane | colanic acid biosynthetic process | intracellular | intracellular signal transduction |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >405
atgcgtgctttaccgatctgtttagtagcactcatgctaagcggctgttccatgttaagc
agatcccctgtcgaacccgttcaaagcactgcaccccagccgaaagcggagcctgcaaaa
ccgaaagcgccgcgcgccacgccggtccgaatttataccaatgcagaagaattagtcggc
aaaccgttccgcgatctcggtgaagtcagtggcgactcttgccaggcctctaatcaggac
tctccgccgagcattccaaccgcacgtaagcggatgcaaatcaacgcctctaaaatgaaa
gccaatgctgtattactgcatagctgcgaagtcaccagcggtacgccaggctgctatcgt
caggctgtatgtatcggttctgcgcttaacattacggcgaaatga |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 134 |
---|
Protein Molecular Weight: | 14163 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 2L8Y |
Signaling Regions: | |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Outer membrane lipoprotein RcsF
MRALPICLVALMLSGCSMLSRSPVEPVQSTAPQPKAEPAKPKAPRATPVRIYTNAEELVG
KPFRDLGEVSGDSCQASNQDSPPSIPTARKRMQINASKMKANAVLLHSCEVTSGTPGCYR
QAVCIGSALNITAK |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|