Endonuclease V (P68739)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Name: | Endonuclease V | ||||||||
| Synonyms: | Not Available | ||||||||
| Gene Name: | nfi | ||||||||
| Enzyme Class: | |||||||||
| Biological Properties | |||||||||
| General Function: | DNA repair | ||||||||
| Specific Function: | DNA repair enzyme involved in the repair of deaminated bases. Selectively cleaves double-stranded DNA at the second phosphodiester bond 3' to a deoxyinosine leaving behind the intact lesion on the nicked DNA. Has a wide substrate spectrum. In addition to deoxyinosine-containing DNA, the enzyme cleaves DNA containing urea residues, AP sites, base mismatches, insertion/deletion mismatches, flaps, and pseudo-Y structures. Participates in the excision repair of hypoxanthine and xanthine (deaminated adenine and guanine) in DNA. It thereby reduces the mutagenic effects of nitrous acid by attacking lesions caused by nitrosative deamination. Also active on inosines in single- and double-stranded RNA. May cleave tRNA(Arg2), which contains inosine at the wobble position. | ||||||||
| Cellular Location: | Not Available | ||||||||
| SMPDB Pathways: | Not Available | ||||||||
| KEGG Pathways: | Not Available | ||||||||
| Metabolites: |
| ||||||||
| GO Classification: |
| ||||||||
| Gene Properties | |||||||||
| Blattner: | Not Available | ||||||||
| Gene Orientation | Not Available | ||||||||
| Centisome Percentage: | Not Available | ||||||||
| Left Sequence End | Not Available | ||||||||
| Right Sequence End | Not Available | ||||||||
| Gene Sequence: | >672 atggatctcgcgtcattacgcgctcaacaaatcgaactggcttcttctgtgatccgcgag gatcgactcgataaagatccaccggatctgatcgccggagccgatgtcgggtttgagcag ggcggagaagtgacgcgagcggcgatggtgctgctgaaatatccctcgcttgagctggtc gagtataaagttgcccgcatcgccaccaccatgccttacattccaggttttctttccttc cgcgaatatcctgcgctgctggcagcgtgggagatgctgtcgcaaaagccggatttagtg tttgtcgatggtcatgggatctcgcatcctcgccgtcttggcgtcgccagccattttggc ttattggtggatgtgccgaccattggcgtggcgaaaaaacggctctgcggtaaattcgaa ccgctctccagcgaaccgggcgcgctggccccactgatggataaaggcgagcagctggcc tgggtctggcgcagcaaagcgcgctgtaacccgttgtttatcgctaccggccatcgggtc agcgtggacagcgcgctggcgtgggtacaacgctgcatgaaaggctatcgtctgccggag ccaacgcgctgggcggacgcggtggcctcggaacgtccggcgttcgtgcgctatacagca aatcagccctaa | ||||||||
| Protein Properties | |||||||||
| Pfam Domain Function: | Not Available | ||||||||
| Protein Residues: | 223 | ||||||||
| Protein Molecular Weight: | 24672 | ||||||||
| Protein Theoretical pI: | Not Available | ||||||||
| Signaling Regions: | Not Available | ||||||||
| Transmembrane Regions: | Not Available | ||||||||
| Protein Sequence: | >Endonuclease V MDLASLRAQQIELASSVIREDRLDKDPPDLIAGADVGFEQGGEVTRAAMVLLKYPSLELV EYKVARIATTMPYIPGFLSFREYPALLAAWEMLSQKPDLVFVDGHGISHPRRLGVASHFG LLVDVPTIGVAKKRLCGKFEPLSSEPGALAPLMDKGEQLAWVWRSKARCNPLFIATGHRV SVDSALAWVQRCMKGYRLPEPTRWADAVASERPAFVRYTANQP | ||||||||
| References | |||||||||
| External Links: |
| ||||||||
| General Reference: | Not Available | ||||||||