| Identification |
|---|
| Name: | Autoinducer 2-degrading protein LsrG |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | lsrG |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | metabolic process |
|---|
| Specific Function: | Involved in the degradation of phospho-AI-2, thereby terminating induction of the lsr operon and closing the AI-2 signaling cycle. Catalyzes the cleavage of phosphorylated 4,5-dihydroxy-2,3-pentanedione (P-DPD) to 2-phosphoglycolic acid (PG) and another three-carbon compound. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | |
|---|
| KEGG Pathways: | Not Available |
|---|
| SMPDB Reactions: | |
1.0(4S)-4-hydroxy-2,3-pentanedione 5-phosphate | + | 1.0 | → | 1.03-hydroxy-2,4-pentanedione 5-phosphate | + | 1.0 |
| |
|
|---|
| Metabolites: | | ECMDB ID | Name | View |
|---|
| ECMDB24233 | (4S)-4-hydroxy-2,3-pentanedione 5-phosphate | MetaboCard | | ECMDB24234 | 3-hydroxy-2,4-pentanedione 5-phosphate | MetaboCard |
|
|---|
| GO Classification: | | Function |
|---|
| catalytic activity | | cytoplasm | | metabolic process |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >291
atgcacgtcacactggttgaaattaacgttcatgaagacaaggttgacgagtttatcgaa
gtttttcgccagaaccacctgggctctgtacaggaagaaggcaatttgcgcttcgatgtc
ttacaggacccggaagtgaattcgcgcttttatatctacgaagcctataaagatgaagac
gcagtggcgttccataaaaccacgccccactacaaaacctgtgtcgcgaaactggaatct
ttaatgaccgggccgcgtaaaaaacgtctgttcaatggtttgatgccgtga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 96 |
|---|
| Protein Molecular Weight: | 11254 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Autoinducer 2-degrading protein LsrG
MHVTLVEINVHEDKVDEFIEVFRQNHLGSVQEEGNLRFDVLQDPEVNSRFYIYEAYKDED
AVAFHKTTPHYKTCVAKLESLMTGPRKKRLFNGLMP |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|