Identification |
---|
Name: | Autoinducer 2-degrading protein LsrG |
---|
Synonyms: | Not Available |
---|
Gene Name: | lsrG |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | metabolic process |
---|
Specific Function: | Involved in the degradation of phospho-AI-2, thereby terminating induction of the lsr operon and closing the AI-2 signaling cycle. Catalyzes the cleavage of phosphorylated 4,5-dihydroxy-2,3-pentanedione (P-DPD) to 2-phosphoglycolic acid (PG) and another three-carbon compound. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | |
---|
KEGG Pathways: | Not Available |
---|
SMPDB Reactions: | |
1.0(4S)-4-hydroxy-2,3-pentanedione 5-phosphate | + | 1.0 | → | 1.03-hydroxy-2,4-pentanedione 5-phosphate | + | 1.0 |
| |
|
---|
Metabolites: | ECMDB ID | Name | View |
---|
ECMDB24233 | (4S)-4-hydroxy-2,3-pentanedione 5-phosphate | MetaboCard | ECMDB24234 | 3-hydroxy-2,4-pentanedione 5-phosphate | MetaboCard |
|
---|
GO Classification: | Function |
---|
catalytic activity | cytoplasm | metabolic process |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >291
atgcacgtcacactggttgaaattaacgttcatgaagacaaggttgacgagtttatcgaa
gtttttcgccagaaccacctgggctctgtacaggaagaaggcaatttgcgcttcgatgtc
ttacaggacccggaagtgaattcgcgcttttatatctacgaagcctataaagatgaagac
gcagtggcgttccataaaaccacgccccactacaaaacctgtgtcgcgaaactggaatct
ttaatgaccgggccgcgtaaaaaacgtctgttcaatggtttgatgccgtga |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 96 |
---|
Protein Molecular Weight: | 11254 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Autoinducer 2-degrading protein LsrG
MHVTLVEINVHEDKVDEFIEVFRQNHLGSVQEEGNLRFDVLQDPEVNSRFYIYEAYKDED
AVAFHKTTPHYKTCVAKLESLMTGPRKKRLFNGLMP |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|