| Identification |
|---|
| Name: | Uncharacterized protein yaeJ |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | yaeJ |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | Translation, ribosomal structure and biogenesis |
|---|
| Specific Function: | Not Available |
|---|
| Cellular Location: | Cytoplasmic |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Complex Reactions: | |
1.0N-substituted aminoacyl-tRNA | + | 1.0 | → | 1.0N-substituted amino acid | + | 1.0tRNA |
| 1.0N-substituted aminoacyl-tRNA + 1.0 Water → 1.0N-substituted amino acid + 1.0tRNA ReactionCard |
|
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| binding | | nucleic acid binding | | RNA binding | | translation factor activity, nucleic acid binding | | translation release factor activity | | translation termination factor activity | | Process |
|---|
| cellular component disassembly | | cellular component organization | | cellular component organization or biogenesis | | cellular macromolecular complex disassembly | | cellular protein complex disassembly | | macromolecular complex disassembly | | translational termination |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >423 bp
ATGATTGTGATTTCCCGACATGTTGCTATTCCCGATGGTGAGCTTGAGATCACCGCCATT
CGTGCGCAGGGCGCGGGCGGGCAGCATGTTAATAAGACCTCAACGGCTATTCATCTGCGT
TTTGACATTCGGGCGTCCAGCCTGCCAGAGTATTACAAAGAGCGTCTGCTCGCCGCCAGC
CATCATTTGATCAGCAGTGATGGCGTGATTGTCATTAAGGCACAGGAATACCGCAGTCAG
GAACTGAACCGCGAAGCAGCTCTGGCCCGGCTGGTGGCTATGATTAAAGAATTAACAACA
GAAAAAAAAGCCCGACGACCCACGCGGCCCACCCGTGCATCGAAAGAGCGCAGGCTGGCA
TCGAAAGCACAAAAATCAAGCGTGAAGGCGATGCGCGGCAAAGTGCGCAGCGGTCGGGAA
TAA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | |
|---|
| Protein Residues: | 140 |
|---|
| Protein Molecular Weight: | 15623 |
|---|
| Protein Theoretical pI: | 11 |
|---|
| Signaling Regions: | |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Uncharacterized protein yaeJ
MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRASSLPEYYKERLLAAS
HHLISSDGVIVIKAQEYRSQELNREAALARLVAMIKELTTEKKARRPTRPTRASKERRLA
SKAQKSSVKAMRGKVRSGRE |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | - Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
- Gupta, S. D., Lee, B. T., Camakaris, J., Wu, H. C. (1995). "Identification of cutC and cutF (nlpE) genes involved in copper tolerance in Escherichia coli." J Bacteriol 177:4207-4215. Pubmed: 7635807
- Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
- Snyder, W. B., Davis, L. J., Danese, P. N., Cosma, C. L., Silhavy, T. J. (1995). "Overproduction of NlpE, a new outer membrane lipoprotein, suppresses the toxicity of periplasmic LacZ by activation of the Cpx signal transduction pathway." J Bacteriol 177:4216-4223. Pubmed: 7635808
|
|---|
