| Identification |
|---|
| Name: | Signal transduction protein PmrD |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | pmrD |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | response to antibiotic |
|---|
| Specific Function: | Interacts with phosphorylated BasR protein to mediate transcriptional induction of BasR-activated genes to induce polymyxin resistance in some natural isolates. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | - Cationic antimicrobial peptide (CAMP) resistance eco01503
|
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| response to antibiotic |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >267
atggaatggctggtcaaaaaatcgtgctgcaataaacaagataacagacatgtacttatg
ctctgcgatgctggcggcgcgataaaaatgatcgccgaagtgaagagtgacttcgccgtg
aaagtgggggatttactctcgcctttgcagaatgcgctttattgtattaatcgtgaaaag
ctgcatacggtgaaagtcctctcggcaagcagttatagccccgatgagtgggaacggcag
tgtaaagtggcagggaaaactcagtaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 88 |
|---|
| Protein Molecular Weight: | 9870 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2JSO |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Signal transduction protein PmrD
MEWLVKKSCCNKQDNRHVLMLCDAGGAIKMIAEVKSDFAVKVGDLLSPLQNALYCINREK
LHTVKVLSASSYSPDEWERQCKVAGKTQ |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
