Multidrug transporter emrE (P23895)

Identification
Name:Multidrug transporter emrE
Synonyms:
  • Efflux-multidrug resistance protein emrE
  • Ethidium resistance protein
  • Methyl viologen resistance protein C
Gene Name:emrE
Enzyme Class:Not Available
Biological Properties
General Function:Inorganic ion transport and metabolism
Specific Function:Multidrug transporter that expels positively charged hydrophobic drugs across the inner membrane of E.coli., thereby conferring resistance to a wide range of toxic compounds. The drug efflux is coupled to an influx of protons. Is involved in the resistance of E.coli cells to methyl viologen, ethidium bromide and acriflavine. Is also able to transport tetraphenylphosphonium (TPP(+)) and benzalkonium
Cellular Location:Cell inner membrane; Multi-pass membrane protein
SMPDB Pathways:Not Available
KEGG Pathways:Not Available
Metabolites:
ECMDB IDNameView
GO Classification:
Component
cell part
integral to membrane
intrinsic to membrane
membrane part
Gene Properties
Blattner:b0543
Gene OrientationClockwise
Centisome Percentage:12.23
Left Sequence End567538
Right Sequence End567870
Gene Sequence:
>333 bp
ATGAGCTTTTTTATTTCTGATGCGGTAGCGGCAACGGGTGCACCGGCGCAAGGTAGCCCG
ATGTCTTTGATTTTGATGCTGGTGGTATTCGGTCTGATTTTCTATTTCATGATCCTGCGT
CCACAGCAGAAGCGCACCAAAGAACACAAAAAGCTGATGGACTCCATTGCCAAAGGTGAT
GAAGTTCTGACGAACGGTGGCCTGGTTGGTCGCGTAACCAAAGTAGCGGAAAACGGCTAC
ATTGCTATCGCGCTGAATGACACCACTGAAGTAGTTATTAAACGTGACTTCGTAGCTGCC
GTCCTGCCGAAAGGCACCATGAAGGCGCTGTAA
Protein Properties
Pfam Domain Function:
Protein Residues:110
Protein Molecular Weight:11958
Protein Theoretical pI:8
PDB File:1S7B
Signaling Regions:
  • None
Transmembrane Regions:
  • 4-21
  • 34-52
  • 58-81
  • 85-105
Protein Sequence:
>Multidrug transporter emrE
MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAYIPTGIAY
AIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSRSTPH
References
External Links:
ResourceLink
Uniprot ID:P23895
Uniprot Name:EMRE_ECOLI
GenBank Gene ID:AP009048
Genebank Protein ID:85674547
PDB ID:1S7B
Ecogene ID:EG10629
Ecocyc:EG10629
ColiBase:b0543
Kegg Gene:b0543
EchoBASE ID:EB0623
CCDB:EMRE_ECOLI
BacMap:16128526
General Reference:
  • Blattner, F. R., Plunkett, G. 3rd, Bloch, C. A., Perna, N. T., Burland, V., Riley, M., Collado-Vides, J., Glasner, J. D., Rode, C. K., Mayhew, G. F., Gregor, J., Davis, N. W., Kirkpatrick, H. A., Goeden, M. A., Rose, D. J., Mau, B., Shao, Y. (1997). "The complete genome sequence of Escherichia coli K-12." Science 277:1453-1462. Pubmed: 9278503
  • Chang, G., Roth, C. B., Reyes, C. L., Pornillos, O., Chen, Y. J., Chen, A. P. (2006). "Retraction." Science 314:1875. Pubmed: 17185584
  • Daley, D. O., Rapp, M., Granseth, E., Melen, K., Drew, D., von Heijne, G. (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308:1321-1323. Pubmed: 15919996
  • Elbaz, Y., Steiner-Mordoch, S., Danieli, T., Schuldiner, S. (2004). "In vitro synthesis of fully functional EmrE, a multidrug transporter, and study of its oligomeric state." Proc Natl Acad Sci U S A 101:1519-1524. Pubmed: 14755055
  • Elbaz, Y., Tayer, N., Steinfels, E., Steiner-Mordoch, S., Schuldiner, S. (2005). "Substrate-induced tryptophan fluorescence changes in EmrE, the smallest ion-coupled multidrug transporter." Biochemistry 44:7369-7377. Pubmed: 15882076
  • Fleishman, S. J., Harrington, S. E., Enosh, A., Halperin, D., Tate, C. G., Ben-Tal, N. (2006). "Quasi-symmetry in the cryo-EM structure of EmrE provides the key to modeling its transmembrane domain." J Mol Biol 364:54-67. Pubmed: 17005200
  • Gutman, N., Steiner-Mordoch, S., Schuldiner, S. (2003). "An amino acid cluster around the essential Glu-14 is part of the substrate- and proton-binding domain of EmrE, a multidrug transporter from Escherichia coli." J Biol Chem 278:16082-16087. Pubmed: 12590142
  • Hayashi, K., Morooka, N., Yamamoto, Y., Fujita, K., Isono, K., Choi, S., Ohtsubo, E., Baba, T., Wanner, B. L., Mori, H., Horiuchi, T. (2006). "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Mol Syst Biol 2:2006.0007. Pubmed: 16738553
  • Ma, C., Chang, G. (2004). "Structure of the multidrug resistance efflux transporter EmrE from Escherichia coli." Proc Natl Acad Sci U S A 101:2852-2857. Pubmed: 14970332
  • Morimyo, M., Hongo, E., Hama-Inaba, H., Machida, I. (1992). "Cloning and characterization of the mvrC gene of Escherichia coli K-12 which confers resistance against methyl viologen toxicity." Nucleic Acids Res 20:3159-3165. Pubmed: 1320256
  • Ninio, S., Elbaz, Y., Schuldiner, S. (2004). "The membrane topology of EmrE - a small multidrug transporter from Escherichia coli." FEBS Lett 562:193-196. Pubmed: 15044024
  • Pornillos, O., Chen, Y. J., Chen, A. P., Chang, G. (2005). "X-ray structure of the EmrE multidrug transporter in complex with a substrate." Science 310:1950-1953. Pubmed: 16373573
  • Purewal, A. S. (1991). "Nucleotide sequence of the ethidium efflux gene from Escherichia coli." FEMS Microbiol Lett 66:229-231. Pubmed: 1936950
  • Rotem, D., Schuldiner, S. (2004). "EmrE, a multidrug transporter from Escherichia coli, transports monovalent and divalent substrates with the same stoichiometry." J Biol Chem 279:48787-48793. Pubmed: 15371426
  • Rotem, D., Steiner-Mordoch, S., Schuldiner, S. (2006). "Identification of tyrosine residues critical for the function of an ion-coupled multidrug transporter." J Biol Chem 281:18715-18722. Pubmed: 16672221
  • Schuldiner, S., Granot, D., Mordoch, S. S., Ninio, S., Rotem, D., Soskin, M., Tate, C. G., Yerushalmi, H. (2001). "Small is mighty: EmrE, a multidrug transporter as an experimental paradigm." News Physiol Sci 16:130-134. Pubmed: 11443233
  • Schuldiner, S., Lebendiker, M., Yerushalmi, H. (1997). "EmrE, the smallest ion-coupled transporter, provides a unique paradigm for structure-function studies." J Exp Biol 200:335-341. Pubmed: 9050242
  • Schwaiger, M., Lebendiker, M., Yerushalmi, H., Coles, M., Groger, A., Schwarz, C., Schuldiner, S., Kessler, H. (1998). "NMR investigation of the multidrug transporter EmrE, an integral membrane protein." Eur J Biochem 254:610-619. Pubmed: 9688273
  • Sharoni, M., Steiner-Mordoch, S., Schuldiner, S. (2005). "Exploring the binding domain of EmrE, the smallest multidrug transporter." J Biol Chem 280:32849-32855. Pubmed: 16049002
  • Soskine, M., Mark, S., Tayer, N., Mizrachi, R., Schuldiner, S. (2006). "On parallel and antiparallel topology of a homodimeric multidrug transporter." J Biol Chem 281:36205-36212. Pubmed: 17003034
  • Ubarretxena-Belandia, I., Baldwin, J. M., Schuldiner, S., Tate, C. G. (2003). "Three-dimensional structure of the bacterial multidrug transporter EmrE shows it is an asymmetric homodimer." EMBO J 22:6175-6181. Pubmed: 14633977
  • Ubarretxena-Belandia, I., Tate, C. G. (2004). "New insights into the structure and oligomeric state of the bacterial multidrug transporter EmrE: an unusual asymmetric homo-dimer." FEBS Lett 564:234-238. Pubmed: 15111102
  • Yerushalmi, H., Lebendiker, M., Schuldiner, S. (1995). "EmrE, an Escherichia coli 12-kDa multidrug transporter, exchanges toxic cations and H+ and is soluble in organic solvents." J Biol Chem 270:6856-6863. Pubmed: 7896833
  • Yerushalmi, H., Schuldiner, S. (2000). "An essential glutamyl residue in EmrE, a multidrug antiporter from Escherichia coli." J Biol Chem 275:5264-5269. Pubmed: 10681497