Single-stranded DNA-binding protein (P0AGE0)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
Name: | Single-stranded DNA-binding protein | ||||||||||
Synonyms: | Not Available | ||||||||||
Gene Name: | ssb | ||||||||||
Enzyme Class: | Not Available | ||||||||||
Biological Properties | |||||||||||
General Function: | SOS response | ||||||||||
Specific Function: | Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of action during DNA metabolism. Acts as a sliding platform that migrates on DNA via reptation. | ||||||||||
Cellular Location: | Not Available | ||||||||||
SMPDB Pathways: | Not Available | ||||||||||
KEGG Pathways: |
| ||||||||||
Metabolites: |
| ||||||||||
GO Classification: |
| ||||||||||
Gene Properties | |||||||||||
Blattner: | Not Available | ||||||||||
Gene Orientation | Not Available | ||||||||||
Centisome Percentage: | Not Available | ||||||||||
Left Sequence End | Not Available | ||||||||||
Right Sequence End | Not Available | ||||||||||
Gene Sequence: | >537 atggccagcagaggcgtaaacaaggttattctcgttggtaatctgggtcaggacccggaa gtacgctacatgccaaatggtggcgcagttgccaacattacgctggctacttccgaatcc tggcgtgataaagcgaccggcgagatgaaagaacagactgaatggcaccgcgttgtgctg ttcggcaaactggcagaagtggcgagcgaatatctgcgtaaaggttctcaggtttatatc gaaggtcagctgcgtacccgtaaatggaccgatcaatccggtcaggatcgctacaccaca gaagtcgtggtgaacgttggcggcaccatgcagatgctgggtggtcgtcagggtggtggc gctccggcaggtggcaatatcggtggtggtcagccgcagggcggttggggtcagcctcag cagccgcagggtggcaatcagttcagcggcggcgcgcagtctcgcccgcagcagtccgct ccggcagcgccgtctaacgagccgccgatggactttgatgatgacattccgttctga | ||||||||||
Protein Properties | |||||||||||
Pfam Domain Function: | Not Available | ||||||||||
Protein Residues: | 178 | ||||||||||
Protein Molecular Weight: | 18975 | ||||||||||
Protein Theoretical pI: | Not Available | ||||||||||
PDB File: | 1EQQ | ||||||||||
Signaling Regions: | Not Available | ||||||||||
Transmembrane Regions: | Not Available | ||||||||||
Protein Sequence: | >Single-stranded DNA-binding protein MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVL FGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGG APAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSAPAAPSNEPPMDFDDDIPF | ||||||||||
References | |||||||||||
External Links: |
| ||||||||||
General Reference: | Not Available |