| Identification |
|---|
| Name: | Protein translocase subunit SecE |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | secE |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | protein transport by the Sec complex |
|---|
| Specific Function: | Essential subunit of the protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation. Overexpression of some hybrid proteins has been thought to jam the protein secretion apparatus resulting in cell death; while this may be true it also results in FtsH-mediated degradation of SecY. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Transports: | |
|---|
| Transport References: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cell envelope Sec protein transport complex | | integral component of membrane | | integral component of plasma membrane | | intracellular | | intracellular protein transmembrane transport | | intracellular protein transport | | P-P-bond-hydrolysis-driven protein transmembrane transporter activity | | plasma membrane | | protein secretion | | protein targeting | | protein transport by the Sec complex |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >384
atgagtgcgaataccgaagctcaaggaagcgggcgcggcctggaagcgatgaagtgggtc
gttgtggtggcattgctcctggtggcgattgtcggcaactatctttatcgcgacattatg
ctgccgctgcgtgcgctggccgtagtaattctgattgctgcagcgggtggtgtcgcgctg
ttaacgacaaaaggtaaagctaccgttgcttttgcccgtgaagcgcgtaccgaagtccgt
aaggtcatttggccgactcgccaggaaacattgcacaccacgctgattgtggctgcggtt
accgcagtaatgtcactgatcctgtggggactggatggtattctggttcgcctggtatcc
tttatcactggcctgaggttctga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 127 |
|---|
| Protein Molecular Weight: | 13643 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2AKH |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Protein translocase subunit SecE
MSANTEAQGSGRGLEAMKWVVVVALLLVAIVGNYLYRDIMLPLRALAVVILIAAAGGVAL
LTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVMSLILWGLDGILVRLVS
FITGLRF |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|