| Identification |
|---|
| Name: | Protein-export protein SecB |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | secB |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | protein transport by the Sec complex |
|---|
| Specific Function: | One of the proteins required for the normal export of some preproteins out of the cell cytoplasm. It is a molecular chaperone that binds to a subset of precursor proteins, maintaining them in a translocation-competent state. It also specifically binds to its receptor SecA. Its substrates include AmpC, DegP, FhuA, FkpA, GBP, LamB, MalE (MBP), OmpA, OmpF, OmpT, OmpX, OppA, PhoE, TolB, TolC, YbgF, YcgK, YgiW and YncE. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytosol | | protein folding | | protein targeting | | protein tetramerization | | protein transport | | protein transport by the Sec complex | | unfolded protein binding |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >468
atgtcagaacaaaacaacactgaaatgactttccagatccaacgtatttataccaaggat
atctctttcgaagcgccgaacgcgccgcacgttttccagaaagattggcaaccagaagtt
aaacttgatctggatacggcatcttcccaactggcagatgacgtatacgaagtggtactg
cgtgttaccgtaacggcctctttgggcgaagaaaccgcgttcctgtgtgaagttcagcag
ggcggtattttctccatcgcgggtatcgaaggcacccagatggcgcattgcctgggagca
tactgcccgaacattctgttcccgtatgctcgtgagtgcatcaccagcatggtatcccgc
ggtacattcccgcaactgaaccttgcgccggttaacttcgatgcgctgttcatgaactat
ttgcagcagcaggctggcgaaggtactgaagaacatcaggatgcctga |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 155 |
|---|
| Protein Molecular Weight: | 17277 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1QYN |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Protein-export protein SecB
MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVL
RVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSR
GTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|
