| Identification |
|---|
| Name: | 30S ribosomal protein S17 |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | rpsQ |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | translation |
|---|
| Specific Function: | One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA. Also plays a role in translational accuracy; neamine-resistant ribosomes show reduced neamine-induced misreading in vitro. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cytosolic small ribosomal subunit | | response to antibiotic | | rRNA binding | | small ribosomal subunit rRNA binding | | structural constituent of ribosome | | translation |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >255
atgaccgataaaatccgtactctgcaaggtcgcgttgttagcgacaaaatggagaaatcc
attgttgttgctatcgaacgttttgtgaaacacccgatctacggtaaattcatcaagcgt
acgaccaaactgcacgtacatgacgagaacaacgaatgcggtatcggtgacgtggttgaa
atccgcgaatgccgtccgctgtccaagactaaatcctggacgctggttcgcgttgtagag
aaagcggttctgtaa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 84 |
|---|
| Protein Molecular Weight: | 9704 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 1EG0 |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >30S ribosomal protein S17
MTDKIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVE
IRECRPLSKTKSWTLVRVVEKAVL |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|