Identification |
---|
Name: | Endoribonuclease GhoS |
---|
Synonyms: | Not Available |
---|
Gene Name: | ghoS |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | transcription, DNA-templated |
---|
Specific Function: | Antitoxin component of a type V toxin-antitoxin (TA) module. Neutralizes the toxic effects of toxin GhoT by digesting ghoT transcripts in a sequence-specific manner (PubMed:22941047). In concert with GhoT is involved in reducing cell growth during antibacterial stress (PubMed:24373067). Overexpression leads to transcript level reduction of 20 other mRNAs involved in purine or pyrimidine synthesis and transport. Not seen to bind its own promoter DNA (PubMed:22941047). |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | Not Available |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
endoribonuclease activity | regulation of transcription, DNA-templated | RNA phosphodiester bond hydrolysis, endonucleolytic | transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >297
atggaaggtaaaaacaagttcaatacttatgttgtttcttttgattatccatcatcttat
tcctcagtgttcttaagattaagatcattgatgtatgatatgaatttctcctctatcgtg
gctgatgaatatgggataccacgacaattgaatgaaaactccttcgcaataacgacatcg
ttagccgcaagtgaaatcgaagatttaatcaggctcaaatgcttagacttaccggatatt
gattttgacctcaacattatgacagttgatgactatttccgtcagttttacaagtag |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 98 |
---|
Protein Molecular Weight: | 11467 |
---|
Protein Theoretical pI: | Not Available |
---|
PDB File: | 2LLZ |
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Endoribonuclease GhoS
MEGKNKFNTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQLNENSFAITTS
LAASEIEDLIRLKCLDLPDIDFDLNIMTVDDYFRQFYK |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|