| Identification |
|---|
| Name: | Endoribonuclease GhoS |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | ghoS |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | transcription, DNA-templated |
|---|
| Specific Function: | Antitoxin component of a type V toxin-antitoxin (TA) module. Neutralizes the toxic effects of toxin GhoT by digesting ghoT transcripts in a sequence-specific manner (PubMed:22941047). In concert with GhoT is involved in reducing cell growth during antibacterial stress (PubMed:24373067). Overexpression leads to transcript level reduction of 20 other mRNAs involved in purine or pyrimidine synthesis and transport. Not seen to bind its own promoter DNA (PubMed:22941047). |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| endoribonuclease activity | | regulation of transcription, DNA-templated | | RNA phosphodiester bond hydrolysis, endonucleolytic | | transcription, DNA-templated |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >297
atggaaggtaaaaacaagttcaatacttatgttgtttcttttgattatccatcatcttat
tcctcagtgttcttaagattaagatcattgatgtatgatatgaatttctcctctatcgtg
gctgatgaatatgggataccacgacaattgaatgaaaactccttcgcaataacgacatcg
ttagccgcaagtgaaatcgaagatttaatcaggctcaaatgcttagacttaccggatatt
gattttgacctcaacattatgacagttgatgactatttccgtcagttttacaagtag |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 98 |
|---|
| Protein Molecular Weight: | 11467 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| PDB File: | 2LLZ |
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | Not Available |
|---|
| Protein Sequence: | >Endoribonuclease GhoS
MEGKNKFNTYVVSFDYPSSYSSVFLRLRSLMYDMNFSSIVADEYGIPRQLNENSFAITTS
LAASEIEDLIRLKCLDLPDIDFDLNIMTVDDYFRQFYK |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|