| Identification |
|---|
| Name: | Cell division protein FtsL |
|---|
| Synonyms: | Not Available |
|---|
| Gene Name: | ftsL |
|---|
| Enzyme Class: | Not Available |
|---|
| Biological Properties |
|---|
| General Function: | FtsZ-dependent cytokinesis |
|---|
| Specific Function: | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. Can also mediate Zn(2+)-sensitivity probably by increasing the permeability of the inner membrane. |
|---|
| Cellular Location: | Not Available |
|---|
| SMPDB Pathways: | Not Available |
|---|
| KEGG Pathways: | Not Available |
|---|
| Metabolites: | |
|---|
| GO Classification: | | Function |
|---|
| cell division site | | FtsZ-dependent cytokinesis | | integral component of plasma membrane |
|
|---|
| Gene Properties |
|---|
| Blattner: | Not Available |
|---|
| Gene Orientation | Not Available |
|---|
| Centisome Percentage: | Not Available |
|---|
| Left Sequence End | Not Available |
|---|
| Right Sequence End | Not Available |
|---|
| Gene Sequence: | >366
atgatcagcagagtgacagaagctctaagcaaagttaaaggatcgatgggaagccacgag
cgccatgcattgcctggtgttatcggtgacgatcttttgcgatttgggaagctgccactc
tgcctgttcatttgcattattttgacggcggtgactgtggtaaccacggcgcaccatacc
cgtttactgaccgctcagcgcgaacaactggtgctggagcgagatgctttagacattgaa
tggcgcaacctgatccttgaagagaatgcgctcggcgaccatagccgggtggaaaggatc
gccacggaaaagctgcaaatgcagcatgttgatccgtcacaagaaaatatcgtagtgcaa
aaataa |
|---|
| Protein Properties |
|---|
| Pfam Domain Function: | Not Available |
|---|
| Protein Residues: | 121 |
|---|
| Protein Molecular Weight: | 13626 |
|---|
| Protein Theoretical pI: | Not Available |
|---|
| Signaling Regions: | Not Available |
|---|
| Transmembrane Regions: | |
|---|
| Protein Sequence: | >Cell division protein FtsL
MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFICIILTAVTVVTTAHHT
RLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEKLQMQHVDPSQENIVVQ
K |
|---|
| References |
|---|
| External Links: | |
|---|
| General Reference: | Not Available |
|---|