Identification |
---|
Name: | Negative regulator of flagellin synthesis |
---|
Synonyms: | Not Available |
---|
Gene Name: | flgM |
---|
Enzyme Class: | Not Available |
---|
Biological Properties |
---|
General Function: | transcription, DNA-templated |
---|
Specific Function: | Responsible for the coupling of flagellin expression to flagellar assembly by preventing expression of the flagellin genes when a component of the middle class of proteins is defective. It negatively regulates flagellar genes by inhibiting the activity of FliA by directly binding to FliA. |
---|
Cellular Location: | Not Available |
---|
SMPDB Pathways: | Not Available |
---|
KEGG Pathways: | |
---|
Metabolites: | |
---|
GO Classification: | Function |
---|
bacterial-type flagellum organization | negative regulation of transcription, DNA-templated | transcription, DNA-templated |
|
---|
Gene Properties |
---|
Blattner: | Not Available |
---|
Gene Orientation | Not Available |
---|
Centisome Percentage: | Not Available |
---|
Left Sequence End | Not Available |
---|
Right Sequence End | Not Available |
---|
Gene Sequence: | >294
atgagtattgatcgcacttcgcctctgaagcctgtaagcaccgttcaaccgcgcgaaacc
actgacgcgccggtaacgaacagccgggcggcaaaaacaaccgcctccaccagcaccagt
gtgacgttaagcgacgcgcaagcaaaactgatgcaacccggcagcagtgatatcaatctt
gaacgtgtcgaagcgttaaaactggcgattcgtaacggtgaactaaaaatggacaccggc
aaaattgccgatgcgctgatcaacgaagcgcagcaagacttgcagagtaactga |
---|
Protein Properties |
---|
Pfam Domain Function: | Not Available |
---|
Protein Residues: | 97 |
---|
Protein Molecular Weight: | 10340 |
---|
Protein Theoretical pI: | Not Available |
---|
Signaling Regions: | Not Available |
---|
Transmembrane Regions: | Not Available |
---|
Protein Sequence: | >Negative regulator of flagellin synthesis
MSIDRTSPLKPVSTVQPRETTDAPVTNSRAAKTTASTSTSVTLSDAQAKLMQPGSSDINL
ERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN |
---|
References |
---|
External Links: | |
---|
General Reference: | Not Available |
---|